dbPTM

YPS1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YPS1_SCHPO
UniProt AC	O59774
Protein Name	Aspartic proteinase yapsin-1
Gene Name	yps1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	521
Subcellular Localization	Endoplasmic reticulum membrane Single-pass membrane protein. Secreted, cell wall.
Protein Description	Cleaves at paired basic residues..
Protein Sequence	MRIWILIFFSFIKLVSSLQYTGNGVLALDFVAKTFPNQENQLEKRDYTYSPSGITSFPLDLQSYTYYTTTLSIGRPSISYTVAIDLDMPYTWLTYYNVMAFNPAYLGIVNSGTQWSTDELRYFLCKKESDSCYFGNASSSFHFVTSPSTFFIRYDDNITVAGINVQDSLSYSHYQALPDFQFGITLKEYVPSSMLPYKGVLGLAASTEINSIDYSDSISSFSPPTFLEQLVKEDILAYPAFSMYLDNQGNGSLLLGAVDTSKYQGQFVALKQTKLTHYAVSIYSVQFLNSTFFSNYSIITDAYFQTRETYIYLPAELAYSVMDNAGAYLSEGYFALNCDEIDLEAALIFQFGCNSTIKVPISLLVIGQVSNICLLGIRPSTDSEIVLGLLFFRNAYTFYHQSQKMIAIGQAFYNATSNLSAIVDQHIPGALTCSQYPTSVASTQLVQTSHFTSTSLSAVNISESVVYSYTSSSSMPSSAIPSFNISLISQNAVANAGNSFSPLSAMVIMMMSAVFLGLGII

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
136	N-linked_Glycosylation	SDSCYFGNASSSFHF CCCCCCCCCCCEEEE	27.10	-
157	N-linked_Glycosylation	FFIRYDDNITVAGIN EEEEECCCEEEEEEE	29.00	-
250	N-linked_Glycosylation	MYLDNQGNGSLLLGA EEEECCCCCEEEEEE	27.41	-
289	N-linked_Glycosylation	IYSVQFLNSTFFSNY EEEEEECCCCCCCCC	40.05	-
295	N-linked_Glycosylation	LNSTFFSNYSIITDA CCCCCCCCCEEEEEC	29.43	-
354	N-linked_Glycosylation	LIFQFGCNSTIKVPI EHHHCCCCCCCCCCE	42.43	-
414	N-linked_Glycosylation	AIGQAFYNATSNLSA EEHHHHHHHCCCHHH	30.23	-
418	N-linked_Glycosylation	AFYNATSNLSAIVDQ HHHHHCCCHHHHHCC	33.39	-
460	N-linked_Glycosylation	STSLSAVNISESVVY CCCCEEEECCCEEEE	31.61	-
484	N-linked_Glycosylation	SSAIPSFNISLISQN CCCCCCEEEEEECCC	27.55	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YPS1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YPS1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YPS1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YPS1_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YPS1_SCHPO

Related Literatures of Post-Translational Modification