dbPTM

RAD31_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAD31_SCHPO
UniProt AC	P79064
Protein Name	DNA damage tolerance protein rad31
Gene Name	rad31
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	307
Subcellular Localization
Protein Description	Could be involved in a ubiquitin-related process important for DNA damage tolerance. Acts in a process which is defective in the checkpoint rad mutants and which involves hus5..
Protein Sequence	MGNHNINAEEIALYDRQIRLWGFNAQQALKQSRVLLITASPLANEIAKNLVLSGIGKLCVLDSMTVYEKDVEEQFFIEASDIGQLRANVFKKKLHELNPLVEIDTDTSLISEIDEGKISKFSMVIATQLDYEEFCRINELTRICNASFYATSCFGLYGFAFCDLINHNFAIDRVVDNTKVEEDMFIVQKPMKEAFQSILGETLKPRLAKKIPTLYPAMLSLLKSKKSDPDSIRQVCIEQKLNEKTVLNGEFLSKFSSNISFQWTPVMSVVGGVVSQDALNSISKKQFPIDNFWIFDAESGLAPIYRL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RAD31_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAD31_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAD31_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAD31_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAD13_SCHPO	rad13	genetic	9092625
HHP2_SCHPO	hhp2	genetic	9092625
RAD5_SCHPO	rad8	genetic	9092625
CHK1_SCHPO	chk1	genetic	9092625
RIR1_SCHPO	cdc22	genetic	9092625
CDC10_SCHPO	cdc10	genetic	9092625
WEE1_SCHPO	wee1	genetic	9092625

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAD31_SCHPO

Related Literatures of Post-Translational Modification