UniProt ID | MPR1_SCHPO | |
---|---|---|
UniProt AC | O94321 | |
Protein Name | Multistep phosphorelay regulator 1 | |
Gene Name | mpr1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 295 | |
Subcellular Localization | ||
Protein Description | Binds to the msc4 response regulator which is part of a multistep phosphorelay system that transmits oxidative stress signals to the spc1 MAPK cascade.. | |
Protein Sequence | MSVYRDNMYMKYDRNFENRVARRNGQARNASLAKTLHDSGIAERARSPSGSAIPHAYRVMNGSGANDTSLPLTSNPAYVALTSRISSSKSENNQQLAANETAGAPEGTEETVDISNSISDDHANAKNLPAASVKALVGAGVLSDELSVIAYDMSFEDELIQDKQLIDHSVFDQLLEMDDDDEHEFSKSIVWNYFEQAETTIADLQKALEAKDLKKLSSLGHFLKGSSAVLGLTKMRKVCERIQNYGSLRSRDGVMKLPSEEIALDLISKSLSVVNDFYKDARAYLLDFYEKNSST | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | GIAERARSPSGSAIP CHHHHHCCCCCCCCC | 23.56 | 28889911 | |
49 | Phosphorylation | AERARSPSGSAIPHA HHHHCCCCCCCCCCE | 46.77 | 29996109 | |
51 | Phosphorylation | RARSPSGSAIPHAYR HHCCCCCCCCCCEEE | 27.62 | 25720772 | |
221 | Phosphorylation | KKLSSLGHFLKGSSA HHHHHHHHHHHHHHH | 30.11 | - | |
227 | Phosphorylation | GHFLKGSSAVLGLTK HHHHHHHHHHHCHHH | 30.94 | 25720772 | |
233 | Phosphorylation | SSAVLGLTKMRKVCE HHHHHCHHHHHHHHH | 22.46 | 25720772 | |
293 | Phosphorylation | LDFYEKNSST----- HHHHHHCCCC----- | 46.55 | 25720772 | |
294 | Phosphorylation | DFYEKNSST------ HHHHHCCCC------ | 47.75 | 25720772 | |
295 | Phosphorylation | FYEKNSST------- HHHHCCCC------- | 42.31 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MPR1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MPR1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MPR1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...