YIP5_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YIP5_SCHPO
• UniProt AC: Q9UTD3
• Protein Name: Protein YIP5
• Gene Name: yip5 {ECO:0000250|UniProtKB:P53108}
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 249
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Description: Possible role in vesicle-mediated transport. May be involved in proper membrane localization of Rab GTPases (By similarity)..
• Protein Sequence: MAHEIEIDSEADLGRTTFEAEDLYKQRTPITKPPAPRLQSRRASMQETPWTIKDSFNVETKDVVQRCIHTLIPTVNFFDVVDDRPDLYGPFWITTTVIQALFFSNSITEYARYATGHGTSGYSIKKLISAASIIYGYTTIIAVLLWGILVWNKCNPKLLDCLCLYGYANIVWLPVSLATPPFGLLSTLASHIVKYVLTGIGLLISIVFLTRNLYPICQQAGSNLCKLLLFGIIVFHCLLALSLQLIFFS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	AHEIEIDSEADLGRT CCEEEECCCCCCCCC	40.10	24763107
44	Phosphorylation	RLQSRRASMQETPWT HHHHCCCCCCCCCCC	21.13	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YIP5_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YIP5_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YIP5_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YIP4_SCHPO	SPAC644.13c	physical	23695164
YIP4_SCHPO	SPAC644.13c	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.