dbPTM

RLA6_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RLA6_SCHPO
UniProt AC	O14317
Protein Name	60S acidic ribosomal protein P2-C
Gene Name	rpp203
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	110
Subcellular Localization	Cytoplasm .
Protein Description	Plays an important role in the elongation step of protein synthesis..
Protein Sequence	MKYLAAYLLLTVGGKNSPSASDIESVLSTVGIESESERVEALIKELDGKDIDELIAAGNEKLATVPSGGAAAAAAPAAAGGAAPAAEEAAKEEAKEEEESDEDMGFGLFD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	VGGKNSPSASDIESV CCCCCCCCHHHHHHH	39.98	25720772
21	Phosphorylation	GKNSPSASDIESVLS CCCCCCHHHHHHHHH	43.38	25720772
25	Phosphorylation	PSASDIESVLSTVGI CCHHHHHHHHHHHCC	28.79	25720772
28	Phosphorylation	SDIESVLSTVGIESE HHHHHHHHHHCCCCH	20.92	25720772
64	Phosphorylation	AGNEKLATVPSGGAA CCCCCEECCCCCHHH	43.30	21712547
100	Phosphorylation	EAKEEEESDEDMGFG HHHHHHHCCCCCCCC	49.97	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RLA6_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RLA6_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RLA6_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of RLA6_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RLA6_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-100, AND MASSSPECTROMETRY.	18257517 [Abstract]