dbPTM

COQ10_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COQ10_SCHPO
UniProt AC	Q9USM9
Protein Name	Coenzyme Q-binding protein coq10, mitochondrial
Gene Name	coq10 {ECO:0000312\|EMBL:CAB53079.1}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	164
Subcellular Localization	Mitochondrion inner membrane Peripheral membrane protein Matrix side .
Protein Description	Required for the function of coenzyme Q in the respiratory chain. May serve as a chaperone or may be involved in the transport of Q6 from its site of synthesis to the catalytic sites of the respiratory complexes (By similarity)..
Protein Sequence	MAFRCTLRRLECYRASRLMPYKPSFLFSLISNVNEYERFVPFCQKSKVTEYDPKTGYPTKADLTVGFKGLCETFDSKVVCDPVALTVLADASHHRLFRRLKTHWSIEEASRGRVRVDLEVDFEFASKLHGMMSKFVGSSVASEIIQGFVQQAKIKHKLESENEK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of COQ10_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COQ10_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COQ10_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COQ10_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of COQ10_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COQ10_SCHPO

Related Literatures of Post-Translational Modification