YB64_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YB64_SCHPO
• UniProt AC: Q09745
• Protein Name: Uncharacterized protein C12C2.04
• Gene Name: SPBC12C2.04
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 384
• Protein Sequence: MTALSTNSSSGGIFKIAIVGAGGINFGTPEGPWNNAQRVEKVLGKSLRVTALINPLINESERVLKSKCASDVAFAYENTKTYVSVTEYLEYLDSHPEDVPSAYLIGIPPDFHGCTTPGMDMELEILRKYPNAALFIEKPITSAPVQGAFNLVHELEKYHAIISIGYMFRYLKIVQAAKKYVADNNLNIACTIARYNSAYEHNNKLFWWYMSKSGGPVVEQATHFCDLSIYFGGDVDTSTVKVNRVNWYDPCGKLAKVPVDEESIPKEERIPRFTAASWKYKSGAVGILAHSIILQGTNYDTCLELQADGHYVRMVDFYGQPRLYIRSPEADSERIINFPEDDPYYNEFDAFLGVVQGRYPPSRILSKFDDGAKTYELTKIITNN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MTALSTNSSSGG ---CCCCCCCCCCCC	24.07	24763107
8	Phosphorylation	MTALSTNSSSGGIFK CCCCCCCCCCCCEEE	26.43	24763107
9	Phosphorylation	TALSTNSSSGGIFKI CCCCCCCCCCCEEEE	34.76	21712547
66	Phosphorylation	ESERVLKSKCASDVA CCHHHHHHHCHHCHH	28.89	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YB64_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YB64_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YB64_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YB64_SCHPO	SPBC12C2.04	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.