UniProt ID | YIU1_SCHPO | |
---|---|---|
UniProt AC | O13777 | |
Protein Name | Uncharacterized protein C1610.01 | |
Gene Name | SPAC1610.01, SPAC17A5.17 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 217 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MITKIDSLPKDLIRKVENGEKLLPNQEIVYFEEKTVPYKIRSDEESFPLGKLITLLVTSQSFILFDEEQNSGWKIPYETITLHAKQSKDKPYVYVQLEGEAIRPLLDHILKFERSSGTLHEAPSTEDENEFTDDFLELTLYVTDVDSCYQALCTCQSLHPDTFSSDNDVENASMGNPMSLFFDPNHQWVTAENVDTSACDNRFDSPESPVLKWHRTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
208 | Phosphorylation | NRFDSPESPVLKWHR CCCCCCCCCCCCEEC | 24.56 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIU1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIU1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIU1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DHX15_SCHPO | prp43 | genetic | 22681890 | |
SMN1_SCHPO | smn1 | genetic | 24298023 | |
SMD1_SCHPO | smd1 | physical | 24298023 | |
SMD3_SCHPO | smd3 | physical | 25274039 | |
RSMB_SCHPO | smb1 | physical | 25274039 | |
SMD1_SCHPO | smd1 | physical | 25274039 | |
SMD2_SCHPO | smd2 | physical | 25274039 | |
SMN1_SCHPO | smn1 | physical | 25274039 | |
SPP42_SCHPO | spp42 | physical | 25274039 | |
RUXE_SCHPO | sme1 | physical | 25274039 | |
YBPF_SCHPO | SPBC16H5.15 | physical | 25274039 | |
RUXG_SCHPO | smg1 | physical | 25274039 | |
RUXF_SCHPO | smf1 | physical | 25274039 | |
CEF1_SCHPO | cdc5 | physical | 25274039 | |
PRP19_SCHPO | prp19 | physical | 25274039 | |
CLF1_SCHPO | cwf4 | physical | 25274039 | |
SN114_SCHPO | cwf10 | physical | 25274039 | |
SMD1_SCHPO | smd1 | physical | 26771498 | |
SMD3_SCHPO | smd3 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...