SMD2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SMD2_SCHPO
• UniProt AC: O14036
• Protein Name: Small nuclear ribonucleoprotein Sm D2
• Gene Name: smd2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 115
• Subcellular Localization: Nucleus .
• Protein Description: Involved in pre-mRNA splicing. Binds snRNA U1, U2, U4 and U5 which contain a highly conserved structural motif called the Sm binding site (By similarity)..
• Protein Sequence: MADLVDKPRSELSEIELARLEEYEFSAGPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMWTEKKRTASGKKGKAINKDRFISKMFLRGDGVVLVVRIPSA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	DLVDKPRSELSEIEL CCCCCCHHHCCHHHH	51.95	29996109
13	Phosphorylation	DKPRSELSEIELARL CCCHHHCCHHHHHHH	32.26	28889911
23	Phosphorylation	ELARLEEYEFSAGPL HHHHHHHCCCCCCHH	16.95	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SMD2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SMD2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SMD2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.