dbPTM

SEC14_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SEC14_SCHPO
UniProt AC	Q10137
Protein Name	Sec14 cytosolic factor
Gene Name	sec14
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	286
Subcellular Localization	Nucleus . Prospore membrane . Nuclear, during meiosis. Associated with the forespore membrane during sporulation. During interphase found at the cell poles and during M-phase is located at both the cell poles and the medial region.
Protein Description	Required for transport of secretory proteins from the Golgi complex. Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes in vitro. Essential for viability and secretion.; Has a direct role in controlling cell septation and in forespore membrane formation..
Protein Sequence	MSETISDPYPLTNPNAPLGHPGHLNSTQQATLDSMRLELQKLGYTERLDDATLLRFLRARKFNLQQSLEMFIKCEKWRKEFGVDDLIKNFHYDEKEAVSKYYPQFYHKTDIDGRPVYVEQLGNIDLKKLYQITTPERMMQNLVYEYEMLALKRFPACSRKAGGLIETSCTIMDLKGVGITSIHSVYSYIRQASSISQDYYPERMGKFYVINAPWGFSSAFNLIKGFLDEATVKKIHILGSNYKSALLEQIPADNLPAKLGGNCQCPGGCELSDAGPWHEEQWMNKN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSETISDPY ------CCCCCCCCC	43.37	29996109
4	Phosphorylation	----MSETISDPYPL ----CCCCCCCCCCC	20.62	29996109
6	Phosphorylation	--MSETISDPYPLTN --CCCCCCCCCCCCC	39.70	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SEC14_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SEC14_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SEC14_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of SEC14_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SEC14_SCHPO

Related Literatures of Post-Translational Modification