dbPTM

CTK3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	CTK3_SCHPO
UniProt AC	Q9USJ8
Protein Name	CTD kinase subunit gamma
Gene Name	ctk3 {ECO:0000250\|UniProtKB:P46963}
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	218
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description	Subunit of the CTDK-I complex, which hyperphosphorylates the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit. As part of the CTDK-I complex, involved in RNA polymerase II transcriptional elongation and pre-mRNA 3'-end processing. Together with ctk2, required for ctk1/lsk1 CTD kinase activation (By similarity)..
Protein Sequence	MDPFEGRMTFLQLLGKLNASQFSQIKPAQFAIKHLDLEEDLYSCIWEELESGSFNTRVNIMYFVDTLCEMCLKNGLTGGYLNMISRDICKLVQNVAPIGAAGAANAPEVRKVLQSLHEKKVIDDNQYKDAMATVEAHEQASKSGDTSTSGAISKNDILKRIEEDRERHKRMRENIWAISEPELEAEIAWNTTQGITESDLESLKDEYEKFNECLHATS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of CTK3_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of CTK3_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of CTK3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of CTK3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
STE11_SCHPO	ste11	genetic	22144909

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of CTK3_SCHPO

Related Literatures of Post-Translational Modification