dbPTM

ELOF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ELOF1_SCHPO
UniProt AC	O13868
Protein Name	Transcription elongation factor 1 homolog
Gene Name	SPAC1B3.02c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	107
Subcellular Localization	Nucleus.
Protein Description	Transcription elongation factor implicated in the maintenance of proper chromatin structure in actively transcribed regions..
Protein Sequence	MGKRKAKAKVKPKRRAPPLDTTFTCLFCNHEKSVSCSLDKQSGVGNLHCKICGQSHQCLITALSAPIDVYSDWIDACDAVANQAKEVDNINDQEAYSPEAAYEEEKE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
97	Phosphorylation	INDQEAYSPEAAYEE CCHHHCCCHHHHHHH	24.26	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ELOF1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ELOF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ELOF1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PNK1_SCHPO	pnk1	genetic	18818364
YB3C_SCHPO	cay1	genetic	18818364
HRR1_SCHPO	hrr1	genetic	18818364
POM1_SCHPO	pom1	genetic	18818364
RSC1_SCHPO	rsc1	genetic	18818364
ASL1_SCHPO	asl1	genetic	22681890
TAL1_SCHPO	tal1	genetic	22681890
PUB1_SCHPO	pub1	genetic	22681890
HRP3_SCHPO	hrp3	genetic	22681890
ALY2_SCHPO	SPBC2D10.04	genetic	22681890
UTP16_SCHPO	utp16	genetic	22681890
AMT1_SCHPO	amt1	genetic	22681890
PLPHP_SCHPO	SPAC644.09	genetic	22681890
RNC1_SCHPO	rnc1	genetic	22681890
YAA7_SCHPO	ime4	genetic	22681890
YHXB_SCHPO	SPBC3E7.11c	genetic	22681890
PLB2_SCHPO	SPAC1A6.03c	genetic	22681890
FEP1_SCHPO	fep1	genetic	22681890
PUF3_SCHPO	puf3	genetic	22681890
CWF16_SCHPO	cwf16	genetic	22681890
DAD1_SCHPO	dad1	genetic	22681890
YD1E_SCHPO	SPAC4G9.14	genetic	22681890
YAOG_SCHPO	SPAC11D3.16c	genetic	22681890
LAG1_SCHPO	lag1	genetic	22681890
CISY_SCHPO	cit1	genetic	22681890
CHR1_SCHPO	cfh4	genetic	22681890
RNH2A_SCHPO	rnh201	genetic	22681890
SSN3_SCHPO	srb10	genetic	22681890
YH05_SCHPO	SPBC1685.05	genetic	22681890
HSP71_SCHPO	ssa1	genetic	22681890
MED1_SCHPO	pmc2	genetic	22681890
GLD1_SCHPO	gld1	genetic	22681890
YBPD_SCHPO	SPBC16H5.13	genetic	22681890
TOM70_SCHPO	tom70	genetic	22681890
FFT3_SCHPO	fft3	genetic	22681890
IMA2_SCHPO	imp1	genetic	22681890
PEX13_SCHPO	pex13	genetic	22681890
EMC1_SCHPO	emc1	genetic	22681890
PGM3_SCHPO	SPCC1840.05c	genetic	22681890
ELOF1_SCHPO	SPAC1B3.02c	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ELOF1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-97, AND MASSSPECTROMETRY.	18257517 [Abstract]