UniProt ID | PNK1_SCHPO | |
---|---|---|
UniProt AC | O13911 | |
Protein Name | Bifunctional polynucleotide phosphatase/kinase | |
Gene Name | pnk1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 408 | |
Subcellular Localization | Nucleus . | |
Protein Description | Catalyzes the phosphorylation of DNA at 5'-hydroxyl termini and can dephosphorylate its 3'-phosphate termini. Has a role in the repair of breaks in single-stranded DNA.. | |
Protein Sequence | MSSKKRKSPPQESLTSYFEKSSKSSKKYGSQNKDSDSSSTCLQQKIEIQWSITDSLYIAKYGKLKKTKKFIAFDLDGTLIKTKSGRVFSKDAADWTWWHPSVVPKLKALYQDNYSLVIFSNQNGIPRKPSAGHTFQMKIRAIFESLDLPIVLYAAILKDKFRKPLTGMWNSFLKDVNRSIDLSFIKYVGDAAGRPGDHNSTDLKFAENIGIKFETPEQFFLGHSFVPPNFESFHPKNYLVRNSSSHPYHFKKSEHQEIVVLVGFPSSGKSTLAESQIVTQGYERVNQDILKTKSKCIKAAIEALKKEKSVVIDNTNPTIESRKMWIDIAQEFEIPIRCIHLQSSEELARHNNVFRYIHHNQKQLPEIAFNSFKSRFQMPTVEEGFTNVEEVPFKCLKDYEDTWNYWYE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MSSKKRKSPPQESLT CCCCCCCCCCHHHHH | 45.93 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PNK1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PNK1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PNK1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...