UniProt ID | HIF2_SCHPO | |
---|---|---|
UniProt AC | O74845 | |
Protein Name | Set3 complex subunit hif2 | |
Gene Name | hif2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 564 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of the set3 histone deacetylase complex which is involved in chromatin remodeling and transcription regulation, such as repression of the sporulation gene program.. | |
Protein Sequence | MDTNQVNYIIWRYLKECGYSHTKFAFERETGIQNLDKQWGSTCQVGALVEILQKGLQYVELEKHYVDNHSSNEEASKTSIDGESLVNENPCKLPFYLTVPHICETTLTKADSTNGFCEHNNSNDHQLKILQDKGSGSPSSPVMPFKDKIEKRDIDITMADESNVEKDPARPIAVYNSSPVTEITEIKQVTFTGGEDIKSDFFKVIPTKHPVTCADWRPLLQENYHVYEFSIGMTNATLASVSICEEQNDFKAKTDYCLQSSFDNQDITGVAWNNSGSFLAYAFFSGVIEIYDSHGSQILSFHNNKGPVLSLKWSGTDTYLAAGSADGTITLFDQLKQTQYSIDTLASSVLDIEWISFDEFVTSDVEGSLRVYKVDGKAPVSTVSHAHDNSIVALRYNLRISLLLTASSDTTVKLWSRGDAGAFECLHVFSFSSPVNCIDWNLREGTPILAVASNSIVSMYNAISLQQLAVFMRHTAPVSALSFSHNGRYLATGDTSGGVCIWSCKTAKLFKELGSDNSELIAVTNVLPEEQVNFLRWSFDDKDLLIGKQKKEIICCCDFLHDSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
71 | Phosphorylation | HYVDNHSSNEEASKT HCCCCCCCCCCHHCC | 29996109 | ||
112 | Phosphorylation | TTLTKADSTNGFCEH EECCCCCCCCCCCCC | 25720772 | ||
135 | Phosphorylation | KILQDKGSGSPSSPV EEEEECCCCCCCCCC | 24763107 | ||
137 | Phosphorylation | LQDKGSGSPSSPVMP EEECCCCCCCCCCCC | 28889911 | ||
139 | Phosphorylation | DKGSGSPSSPVMPFK ECCCCCCCCCCCCCC | 28889911 | ||
140 | Phosphorylation | KGSGSPSSPVMPFKD CCCCCCCCCCCCCCH | 28889911 | ||
175 | Phosphorylation | PARPIAVYNSSPVTE CCCCEEEEECCCCCE | 24763107 | ||
177 | Phosphorylation | RPIAVYNSSPVTEIT CCEEEEECCCCCEEE | 21712547 | ||
178 | Phosphorylation | PIAVYNSSPVTEITE CEEEEECCCCCEEEE | 24763107 | ||
181 | Phosphorylation | VYNSSPVTEITEIKQ EEECCCCCEEEEEEE | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HIF2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HIF2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HIF2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...