APQ12_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APQ12_SCHPO
• UniProt AC: O94353
• Protein Name: Nuclear membrane organization protein apq12
• Gene Name: apq12
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 115
• Subcellular Localization: Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Involved in the regulation of lipid homeostasis in the endoplasmic reticulum, thereby impacting nuclear pore complex biogenesis and localization, and nucleocytoplasmic mRNA transport..
• Protein Sequence: MSLTSVLWNFVAKLAVDHGLNTNPDQVFQTVENVGKSFEKYETSFLKSLFNGNLGLSLPSAINILTLIIVLYFSLVIVNKTTSIALALFKTLAVISFFLLIGCLFAYWFINNGSF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
37	Phosphorylation	TVENVGKSFEKYETS HHHHHHHHHHHHHHH	32.48	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APQ12_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APQ12_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APQ12_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC31_SCHPO	cdc31	genetic	22042620
CUT12_SCHPO	cut12	genetic	22042620
SAD1_SCHPO	sad1	genetic	22042620
KMS2_SCHPO	kms2	genetic	22042620

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.