dbPTM

ERD11_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ERD11_SCHPO
UniProt AC	Q9UTD8
Protein Name	Protein ERD1 homolog 1
Gene Name	erd1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	373
Subcellular Localization	Vacuole membrane Multi-pass membrane protein . Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Required for the retention of luminal endoplasmic reticulum proteins, affects glycoprotein processing in the Golgi apparatus..
Protein Sequence	MALIEDLNHFINYFPLVLRLFFLVVFGLYSFTLILHLLVINRVDVFSLLHTPLPVNRSQQANAPLWQLSFSLSILGTLLFVIAESLYLISGSDELAYVPVFIFGVIVFMPVHKFWFFQRKVFTRQCLRILGGSYRPDYKFPDVIFSDLLTSYSRVIADLWLAGAILIYVTDSPNNSHRKQYENEVIMSMIAAYPYAIRFRQCLIERSSADNSSDKFWSTLNSIKYFTAFPAIFLGIFAKKRFSFLWFLWNTSSAINSTYSFWWDVSMDWSLPFFKQPLSIQNWKFGVRRLFPTFTFAVVSAIDFVLRMAWVVRVLPEHQSAFFTTDFGIFIMQFLEVFRRCVWVFFRIEAEASKSLAYVNISDRSDIPTIHPD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of ERD11_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ERD11_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ERD11_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ERD11_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ERD11_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ERD11_SCHPO

Related Literatures of Post-Translational Modification