CAF1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAF1_SCHPO
• UniProt AC: O74856
• Protein Name: Poly(A) ribonuclease pop2
• Gene Name: caf1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 335
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Acts as the catalytic component of the CCR4-NOT core complex, which in the nucleus seems to be a general transcription factor, and in the cytoplasm the major mRNA deadenylase involved in mRNA turnover. In vivo and in vitro, caf1 has 3'-exoribonuclease activity with a preference for poly(A) RNAs..
• Protein Sequence: MTAMNSNFSYPALGVDGISSQISPIRDVWSTNLQQEMNLIMSLIERYPVVSMDTEFPGVVARPLGVFKSSDDYHYQTLRANVDSLKIIQIGLALSDEEGNAPVEACTWQFNFTFNLQDDMYAPESIELLTKSGIDFKKHQEVGIEPADFAELLIGSGLVLQEEVTWITFHSGYDFAYLLKAMTQIPLPAEYEEFYKILCIYFPKNYDIKYIMKSVLNNSKGLQDIADDLQIHRIGPQHQAGSDALLTARIFFEIRSRYFDGSIDSRMLNQLYGLGSTGSVLWHNNSSTPQIQFRDLPGAHPSPTPSNAGIPTTLTNTSSAPNFANSTFRFPPRVV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
277	Phosphorylation	QLYGLGSTGSVLWHN HHHCCCCCCCEEEEC	31.51	29996109
279	Phosphorylation	YGLGSTGSVLWHNNS HCCCCCCCEEEECCC	17.71	29996109
286	Phosphorylation	SVLWHNNSSTPQIQF CEEEECCCCCCCEEE	40.69	29996109
287	Phosphorylation	VLWHNNSSTPQIQFR EEEECCCCCCCEEEE	46.35	29996109
288	Phosphorylation	LWHNNSSTPQIQFRD EEECCCCCCCEEEEC	21.02	29996109
302	Phosphorylation	DLPGAHPSPTPSNAG CCCCCCCCCCCCCCC	31.38	28889911
304	Phosphorylation	PGAHPSPTPSNAGIP CCCCCCCCCCCCCCC	43.62	28889911
306	Phosphorylation	AHPSPTPSNAGIPTT CCCCCCCCCCCCCCC	41.62	28889911
312	Phosphorylation	PSNAGIPTTLTNTSS CCCCCCCCCCCCCCC	32.30	29996109
317	Phosphorylation	IPTTLTNTSSAPNFA CCCCCCCCCCCCCCC	20.87	29996109
318	Phosphorylation	PTTLTNTSSAPNFAN CCCCCCCCCCCCCCC	26.94	29996109
319	Phosphorylation	TTLTNTSSAPNFANS CCCCCCCCCCCCCCC	45.78	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAF1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAF1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAF1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RIR2_SCHPO	suc22	physical	17264117
RAD26_SCHPO	rad26	genetic	17264117
CDS1_SCHPO	cds1	genetic	17264117
NUP61_SCHPO	nup61	genetic	18818364
AGO1_SCHPO	ago1	genetic	18818364
RNC1_SCHPO	rnc1	genetic	18818364
RAF2_SCHPO	raf2	genetic	18818364
CCR4_SCHPO	ccr4	genetic	18818364
ELP2_SCHPO	elp2	genetic	18818364
NOT2_SCHPO	not2	physical	27851962
RCD1_SCHPO	rcd1	physical	27851962
YAC4_SCHPO	mot2	physical	27851962
CCR4_SCHPO	ccr4	physical	27851962
NOT3_SCHPO	not3	physical	27851962
NOT1_SCHPO	not1	physical	27851962
MMI1_SCHPO	mmi1	physical	27851962

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-302; THR-304 ANDSER-306, AND MASS SPECTROMETRY.
PubMed: 18257517