| UniProt ID | DBR1_SCHPO | |
|---|---|---|
| UniProt AC | O13765 | |
| Protein Name | Lariat debranching enzyme | |
| Gene Name | dbr1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 478 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Cleaves the 2'-5' phosphodiester linkage at the branch point of lariat intron pre-mRNAs after splicing and converts them into linear molecules that are subsequently degraded. It thereby facilitates ribonucleotide turnover (By similarity).. | |
| Protein Sequence | MSYFARLKPPPAFLKMRVGVQGCCHGILDNLYILAEKRKVDLLIIGGDFQALRNVSDYHGISMPPKFKRLGDFFNYYNGRNKAPILTIFVGGNHEASNYLDELPYGGWVAPNIYYMGRSSVINVGGLRIAGISGIYSAMDYKKGRYEGLPYNYKMLKSIYHTREFDVLSLKSLQKPIDIFLSHDWPRGIEQHGDVAKLLRHKPFFRNEVERNDLGSPALEELLVELKPRYWMAAHLHTKFTAVVHHNSQEDDGKLSCSSKDVTSSGFSMKGLNEPSQERLPVEKEQNDKSDEEGSNNEQEEKQDKKQSTNRDLCRKESCKKEPSLSSSDQVTKFLALDKCLPRRSYFEVVEIEPVEIPDSGAPYMQYDSEWLSVLRAMHPFQSHTIEQDPPLPSLEVVKTLKRKEEIWVDENLVKKDKLGIPRNFCQTAPPHSRDITENMQPSSYINPQTVAFEILIGLKERTVDSPPPVKNPNEIVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 268 | Phosphorylation | DVTSSGFSMKGLNEP CCCCCCCCCCCCCCC | 24.10 | 25720772 | |
| 290 | Phosphorylation | EKEQNDKSDEEGSNN CHHHCCCCCCCCCCC | 53.79 | 24763107 | |
| 295 | Phosphorylation | DKSDEEGSNNEQEEK CCCCCCCCCCHHHHH | 39.50 | 21712547 | |
| 463 | Phosphorylation | LIGLKERTVDSPPPV HHCCCCCCCCCCCCC | 29.74 | 24763107 | |
| 466 | Phosphorylation | LKERTVDSPPPVKNP CCCCCCCCCCCCCCC | 34.66 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DBR1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DBR1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DBR1_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
