UniProt ID | VPS71_SCHPO | |
---|---|---|
UniProt AC | O59669 | |
Protein Name | SWR1 complex subunit vps71 | |
Gene Name | vps71 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 139 | |
Subcellular Localization | Nucleus . Cytoplasm . | |
Protein Description | Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.Z leading to transcriptional regulation of selected genes by chromatin remodeling.. | |
Protein Sequence | MFVTPIEHAVQKRKKQKQRSVVDPVTRERQLKRNLADLEKDNFSDIRFEIPKDLLQRRVLPISVRRILSSRKTFVNYLDETPNSRYNTCVAKPSYKPPRKFCNVCGYWGKYACQNCGTSYCSKGCEVIHSETRCMKVYA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of VPS71_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VPS71_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VPS71_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VPS71_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MUB1_SCHPO | SPBC31F10.10c | genetic | 18818364 | |
TMA20_SCHPO | tma20 | genetic | 18818364 | |
MAD1_SCHPO | mad1 | genetic | 18818364 | |
CLR4_SCHPO | clr4 | genetic | 18818364 | |
RSC1_SCHPO | rsc1 | genetic | 18818364 | |
POB3_SCHPO | pob3 | genetic | 18818364 | |
SUM2_SCHPO | sum2 | genetic | 18818364 | |
TAS3_SCHPO | tas3 | genetic | 18818364 | |
RIK1_SCHPO | rik1 | genetic | 18818364 | |
HIF2_SCHPO | hif2 | genetic | 18818364 | |
ERS1_SCHPO | ers1 | genetic | 18818364 | |
PEF1_SCHPO | pef1 | genetic | 18818364 | |
YQ9A_SCHPO | SPCC18.10 | genetic | 18818364 | |
SDC1_SCHPO | sdc1 | genetic | 18818364 | |
2AD1_SCHPO | par1 | genetic | 18818364 | |
BMT5_SCHPO | SPCC1919.13c | genetic | 18818364 | |
CCR4_SCHPO | ccr4 | genetic | 18818364 | |
NOT2_SCHPO | not2 | genetic | 18818364 | |
RAF1_SCHPO | raf1 | genetic | 18818364 | |
AGO1_SCHPO | ago1 | genetic | 18818364 | |
ALP14_SCHPO | alp14 | genetic | 18818364 | |
RAF2_SCHPO | raf2 | genetic | 18818364 | |
PLMT_SCHPO | cho1 | genetic | 18818364 | |
LUB1_SCHPO | lub1 | genetic | 18818364 | |
VPS72_SCHPO | swc2 | genetic | 18818364 | |
RL1DA_SCHPO | SPCC306.07c | genetic | 18818364 | |
ARP6_SCHPO | arp6 | genetic | 18818364 | |
SWC5_SCHPO | swc5 | genetic | 18818364 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...