UniProt ID | SDC1_SCHPO | |
---|---|---|
UniProt AC | O74861 | |
Protein Name | Set1 complex component sdc1 | |
Gene Name | sdc1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 109 | |
Subcellular Localization | Nucleus . | |
Protein Description | The COMPASS (Set1C) complex specifically mono-, di- and trimethylates histone H3 to form H3K4me1/2/3, which subsequently activates gene expression by regulating transcription elongation and plays a role in telomere length maintenance.. | |
Protein Sequence | MSNSAPARQYLNEKVTPVLLEGMKILARDRPENPLQFLGQFLLDANANQQKQKEIVNQPEPQQETPKADADMSTPTMAEQVQTSFSNPASTPLTQTSSPSSNPGKNSAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
65 | Phosphorylation | QPEPQQETPKADADM CCCCCCCCCCCCCCC | 26.25 | 24763107 | |
83 | Phosphorylation | TMAEQVQTSFSNPAS HHHHHHHHHCCCCCC | 32.65 | 27738172 | |
94 | Phosphorylation | NPASTPLTQTSSPSS CCCCCCCCCCCCCCC | 30.88 | 27738172 | |
96 | Phosphorylation | ASTPLTQTSSPSSNP CCCCCCCCCCCCCCC | 26.41 | 27738172 | |
98 | Phosphorylation | TPLTQTSSPSSNPGK CCCCCCCCCCCCCCC | 31.99 | 29996109 | |
100 | Phosphorylation | LTQTSSPSSNPGKNS CCCCCCCCCCCCCCC | 44.70 | 21712547 | |
101 | Phosphorylation | TQTSSPSSNPGKNSA CCCCCCCCCCCCCCC | 50.88 | 27738172 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SDC1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SDC1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SDC1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...