UniProt ID | TRM10_SCHPO | |
---|---|---|
UniProt AC | O14214 | |
Protein Name | tRNA (guanine(9)-N1)-methyltransferase {ECO:0000303|PubMed:24081582} | |
Gene Name | trm10 {ECO:0000303|PubMed:24081582} | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 304 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | S-adenosyl-L-methionine-dependent guanine N(1)-methyltransferase that catalyzes the formation of N(1)-methylguanine at position 9 (m1G9) in cytoplasmic tRNA.. | |
Protein Sequence | MENKDALDIGKDDTNTSEADVSKNETQEQPVLSKSALKRLKRQQEWDAGREKRAEMRREKKRLRKEERKRKIEAGEVVKSQKKRIRLGKVVPSSIRIVLDCAFDDLMNDKEINSLCQQVTRCHSANRTALHPVELFATNFGGRLKTRQDFVLKGQQNNWKRYNPTTKSYLEEFESQKEKLVYLSADSDNTITELDEDKIYIIGAIVDKNRYKNLCQNKASEQGIKTAKLPIDEYIKITDRKILTVNQVFEILSLWLEYRDWEKAFMEVIPKRKGILLKSDESFDVSEDTRSQSNQSDSELEKEN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
14 | Phosphorylation | LDIGKDDTNTSEADV CCCCCCCCCCCHHCC | 50.99 | 21712547 | |
16 | Phosphorylation | IGKDDTNTSEADVSK CCCCCCCCCHHCCCC | 30.00 | 24763107 | |
17 | Phosphorylation | GKDDTNTSEADVSKN CCCCCCCCHHCCCCC | 32.62 | 28889911 | |
22 | Phosphorylation | NTSEADVSKNETQEQ CCCHHCCCCCCCCCC | 30.25 | 21712547 | |
279 | Phosphorylation | RKGILLKSDESFDVS CCEEEEECCCCCCCC | 46.72 | 29996109 | |
282 | Phosphorylation | ILLKSDESFDVSEDT EEEECCCCCCCCHHH | 31.56 | 29996109 | |
286 | Phosphorylation | SDESFDVSEDTRSQS CCCCCCCCHHHHHHC | 31.44 | 29996109 | |
289 | Phosphorylation | SFDVSEDTRSQSNQS CCCCCHHHHHHCCCC | 28.33 | 25720772 | |
291 | Phosphorylation | DVSEDTRSQSNQSDS CCCHHHHHHCCCCHH | 39.80 | 24763107 | |
293 | Phosphorylation | SEDTRSQSNQSDSEL CHHHHHHCCCCHHHH | 37.78 | 24763107 | |
296 | Phosphorylation | TRSQSNQSDSELEKE HHHHCCCCHHHHHHC | 47.56 | 28889911 | |
298 | Phosphorylation | SQSNQSDSELEKEN- HHCCCCHHHHHHCC- | 49.69 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TRM10_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TRM10_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TRM10_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...