UniProt ID | HIBCH_SCHPO | |
---|---|---|
UniProt AC | O74802 | |
Protein Name | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial | |
Gene Name | ehd3 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 429 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a saline catabolite. Has an indirect role in endocytic membrane trafficking. May have a function in protein biosynthesis in mitochondrial small ribosomal subunit (By similarity).. | |
Protein Sequence | MGLKLNISNDLKKSGFMLRQSLLKTSVSNFLSLNASSTMSRAFIRNPKFYSTSSNDTVLYESKNGARIFTLNRPKVLNAINVDMIDSILPKLVSLEESNLAKVIILKGNGRSFSSGGDIKAAALSIQDGKLPEVRHAFAQEYRLSHTLATYQKPVVALMNGITMGGGSGLAMHVPFRIACEDTMFAMPETGIGYFTDVAASFFFSRLPGYFGTYLGLTSQIVKGYDCLRTGIATHFVPKHMFPHLEDRLAELNTSDISKINNTILEFAEFASSSPPTFTPDVMDVINKCFCKNDTVDIIRALKEYASNTSALAEFAKSTVKTLYSKSPTSIAVTNRLIKSAAKWSISEAFYYDHIVSYYMLKQPDFVEGVNAQLITKTKNPKWSKSHEYHFKDLENYFKLPSEYNNGISFAAKGRRKTPLWNYKTYPYL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of HIBCH_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HIBCH_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HIBCH_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HIBCH_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HOG1_SCHPO | sty1 | physical | 23695164 | |
YGK4_SCHPO | SPBC725.04 | physical | 23695164 | |
YGK4_SCHPO | SPBC725.04 | physical | 26771498 | |
SEC6_SCHPO | sec6 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...