dbPTM

HIBCH_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HIBCH_SCHPO
UniProt AC	O74802
Protein Name	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
Gene Name	ehd3
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	429
Subcellular Localization	Mitochondrion .
Protein Description	Hydrolyzes 3-hydroxyisobutyryl-CoA (HIBYL-CoA), a saline catabolite. Has an indirect role in endocytic membrane trafficking. May have a function in protein biosynthesis in mitochondrial small ribosomal subunit (By similarity)..
Protein Sequence	MGLKLNISNDLKKSGFMLRQSLLKTSVSNFLSLNASSTMSRAFIRNPKFYSTSSNDTVLYESKNGARIFTLNRPKVLNAINVDMIDSILPKLVSLEESNLAKVIILKGNGRSFSSGGDIKAAALSIQDGKLPEVRHAFAQEYRLSHTLATYQKPVVALMNGITMGGGSGLAMHVPFRIACEDTMFAMPETGIGYFTDVAASFFFSRLPGYFGTYLGLTSQIVKGYDCLRTGIATHFVPKHMFPHLEDRLAELNTSDISKINNTILEFAEFASSSPPTFTPDVMDVINKCFCKNDTVDIIRALKEYASNTSALAEFAKSTVKTLYSKSPTSIAVTNRLIKSAAKWSISEAFYYDHIVSYYMLKQPDFVEGVNAQLITKTKNPKWSKSHEYHFKDLENYFKLPSEYNNGISFAAKGRRKTPLWNYKTYPYL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of HIBCH_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of HIBCH_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HIBCH_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HIBCH_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HOG1_SCHPO	sty1	physical	23695164
YGK4_SCHPO	SPBC725.04	physical	23695164
YGK4_SCHPO	SPBC725.04	physical	26771498
SEC6_SCHPO	sec6	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HIBCH_SCHPO

Related Literatures of Post-Translational Modification