UniProt ID | CSK1_SCHPO | |
---|---|---|
UniProt AC | P36615 | |
Protein Name | Serine/threonine-protein kinase csk1 | |
Gene Name | csk1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 306 | |
Subcellular Localization | ||
Protein Description | Acts as a CAK-activating kinase that specifically activates crk1 of the crk1-mcs2 CAK complex.. | |
Protein Sequence | MKSVGHFVPWLTDIRHLTDGTISEVFVGERKNSKKLYVIKVQGLVFKRPPHDAMRGKLILESIGHPHIERIVDSFIDNEAGSVYLITSFKSFVLSDVMDEISIDTKCKIVLQISSALEYLEKHGILHRDIHPNNILLDSMNGPAYLSDFSIAWSKQHPGEEVQELIPQIGTGHYRAIETLFGCHSYGHEVDRWTFGILIAELFSNQALFDDGSSEGWPSELRLTSSIIQTLGTPNPSMWPELSTFPDWNKFIFHEYPPKPWSEILPSVDTSIQYIVSHLVTYSNRASPSFVIESFPKVSARLSQYA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CSK1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSK1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSK1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSK1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CRK1_SCHPO | mcs6 | genetic | 9857180 | |
CRK1_SCHPO | mcs6 | genetic | 11226158 | |
CRK1_SCHPO | mcs6 | genetic | 12121616 | |
CRK1_SCHPO | mcs6 | genetic | 10226032 | |
CRK1_SCHPO | mcs6 | physical | 9857180 | |
CDK9_SCHPO | cdk9 | genetic | 18231579 | |
RAD13_SCHPO | rad13 | genetic | 18231579 | |
RAD54_SCHPO | rad54 | genetic | 18231579 | |
SFR1_SCHPO | sfr1 | genetic | 18231579 | |
SNF5_SCHPO | snf5 | genetic | 21169418 | |
YBCB_SCHPO | pho7 | genetic | 21169418 | |
CDK9_SCHPO | cdk9 | physical | 22508988 | |
CDK2_HUMAN | CDK2 | physical | 25691663 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...