UniProt ID | YORS_SCHPO | |
---|---|---|
UniProt AC | O94276 | |
Protein Name | Meiotic chromosome segregation protein P8B7.28c | |
Gene Name | SPBP8B7.28c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 215 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Required for meiotic chromosome segregation.. | |
Protein Sequence | MDFKSRKYKIKKHPKDCKLHAKKYRGTLNSKGKNDNDCLIMCMRCRKVKGIDSYSKTQWSKTFTFVRGRTVSVSDPKVICRTCQPKQHDSIWCTACQQTKGINEFSKAQRHVLDPRCQICVHSQRNDGDDNLESDKFVDPFIGDDSDLDDDIYIHDKQTINSEYADDVSDNTDEERTESKGQQESNSAEEYDDDDSDEDRMEEIFQQFKKEKQIV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
146 | Phosphorylation | DPFIGDDSDLDDDIY CCCCCCCCCCCCCEE | 44.83 | 24763107 | |
153 | Phosphorylation | SDLDDDIYIHDKQTI CCCCCCEEEECCCEE | 10.13 | 21712547 | |
169 | Phosphorylation | SEYADDVSDNTDEER HHHCCCCCCCCHHHH | 31.94 | 21712547 | |
172 | Phosphorylation | ADDVSDNTDEERTES CCCCCCCCHHHHHHC | 50.18 | 21712547 | |
179 | Phosphorylation | TDEERTESKGQQESN CHHHHHHCCCCCCCC | 41.28 | 25720772 | |
187 | Phosphorylation | KGQQESNSAEEYDDD CCCCCCCCCHHCCCC | 46.46 | 25720772 | |
196 | Phosphorylation | EEYDDDDSDEDRMEE HHCCCCCCCHHHHHH | 50.31 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YORS_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YORS_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YORS_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAF2_SCHPO | raf2 | physical | 20211136 | |
CLR4_SCHPO | clr4 | physical | 20211136 | |
RIK1_SCHPO | rik1 | physical | 20211136 | |
AGO1_SCHPO | ago1 | physical | 20211136 | |
MST2_SCHPO | mst2 | genetic | 21289066 | |
RIK1_SCHPO | rik1 | physical | 22319459 | |
CUL4_SCHPO | pcu4 | physical | 20211136 | |
RAF1_SCHPO | raf1 | physical | 20211136 | |
UBL1_SCHPO | ned8 | physical | 20211136 | |
MAS5_SCHPO | mas5 | physical | 20211136 | |
NOP56_SCHPO | SPBC646.10c | physical | 20211136 | |
EBP2_SCHPO | ebp2 | physical | 20211136 | |
NOP58_SCHPO | SPAC23G3.06 | physical | 20211136 | |
SERC_SCHPO | SPAC1F12.07 | physical | 20211136 | |
YORS_SCHPO | stc1 | physical | 20211136 | |
CLR4_SCHPO | clr4 | genetic | 20211136 | |
RIK1_SCHPO | rik1 | genetic | 20211136 | |
RAF1_SCHPO | raf1 | genetic | 20211136 | |
RAF2_SCHPO | raf2 | genetic | 20211136 | |
SIR2_SCHPO | sir2 | genetic | 20211136 | |
CLR4_SCHPO | clr4 | physical | 23613586 | |
RIK1_SCHPO | rik1 | physical | 23613586 | |
RAF1_SCHPO | raf1 | physical | 23613586 | |
RAF2_SCHPO | raf2 | physical | 23613586 | |
AGO1_SCHPO | ago1 | physical | 23613586 | |
RAF2_SCHPO | raf2 | physical | 24449894 | |
RIK1_SCHPO | rik1 | physical | 24449894 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...