| UniProt ID | SERC_SCHPO | |
|---|---|---|
| UniProt AC | Q10349 | |
| Protein Name | Putative phosphoserine aminotransferase | |
| Gene Name | SPAC1F12.07 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 389 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.. | |
| Protein Sequence | MSSREEVVNFAAGPAAMITSVVEEFGKDFVNFQGLGMGVAEISHRSKQGSGIVTSAESNFRKLYNIPENFHILFMQGGGTEQFAACLYNVYAHHALKNGNAKSLVANYIITGAWSKKAYAEAERLGFPCHVAVDMKELAGKYGSLPEDKDLKFTPDGETSLVYYCDNETVHGVEFNEPPTNIPKGAIRVCDVSSNFISRKIDFTKHDIIFAGAQKNAGPAGITVVFVRDSVLARPTPAELHKLNIPVSPTVSDYKIMADNHSLYNTLPVATLHAINLGLEYMLEHGGLVALEASSIEKSKLLYDTLDKHDLYISVVEPAARSRMNVTFRIEPQELESEFLAEAEKHHLVQLKGYRSVGGIRASLYNAISVEQTRRLIDLLESFAKAHSN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | VAEISHRSKQGSGIV HHHHCCCCCCCCCCE | 24.73 | 25720772 | |
| 50 | Phosphorylation | SHRSKQGSGIVTSAE CCCCCCCCCCEECCC | 23.89 | 25720772 | |
| 215 | N6-(pyridoxal phosphate)lysine | IIFAGAQKNAGPAGI EEEEECHHCCCCCCE | 48.51 | - | |
| 215 | Other | IIFAGAQKNAGPAGI EEEEECHHCCCCCCE | 48.51 | - | |
| 354 | Phosphorylation | HLVQLKGYRSVGGIR CEEEECCCCCCCCHH | 9.72 | 25720772 | |
| 356 | Phosphorylation | VQLKGYRSVGGIRAS EEECCCCCCCCHHHH | 19.34 | 25720772 | |
| 382 | Phosphorylation | RLIDLLESFAKAHSN HHHHHHHHHHHHHCC | 30.39 | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SERC_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SERC_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SERC_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of SERC_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
