UniProt ID | LAH1_SCHPO | |
---|---|---|
UniProt AC | P87058 | |
Protein Name | La protein homolog | |
Gene Name | sla1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 298 | |
Subcellular Localization | Nucleus . | |
Protein Description | Binds to the precursors of polymerase III RNAs. Functions in tRNA maturation.. | |
Protein Sequence | MSTEEQKEEIKDISSKQENSSEVPKAEEAGKVVESQKDTTSEEKKEETTEKKEDDGKKDLSFDEAEVLKQVEFYFSDTNLPHDKFLWTTSQKNDGWVPIQTIANFKRMRRFQPLEAIVNALRKSPELLEVDEAGEKVRRMIPLVRVDNKSVMERSVYCKGFGDEKDDTQIALEKFFEENAGPISAVRMRRDDDKKFKGSVFVEFKEPDVANKFLEKVKTAPLKWGEDELTIMSKKEYVDMKAELHKNDPPKFSSKRRRFDAFKEMDRQRPGKYSNRGRKFKKQRSSNASEEKPSAASE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSTEEQKEE ------CCHHHHHHH | 44.52 | 21712547 | |
35 | Phosphorylation | EAGKVVESQKDTTSE HHHHHEECCCCCCCH | 30.81 | 27738172 | |
61 | Phosphorylation | DDGKKDLSFDEAEVL CCCCCCCCCCHHHHH | 40.56 | 28889911 | |
124 | Phosphorylation | IVNALRKSPELLEVD HHHHHHHCHHHHEEC | 19.71 | 28889911 | |
285 | Phosphorylation | RKFKKQRSSNASEEK HHHHCHHCCCCCCCC | 26.00 | 21712547 | |
286 | Phosphorylation | KFKKQRSSNASEEKP HHHCHHCCCCCCCCC | 38.31 | 25720772 | |
289 | Phosphorylation | KQRSSNASEEKPSAA CHHCCCCCCCCCCCC | 51.00 | 21712547 | |
294 | Phosphorylation | NASEEKPSAASE--- CCCCCCCCCCCC--- | 47.75 | 21712547 | |
297 | Phosphorylation | EEKPSAASE------ CCCCCCCCC------ | 43.48 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LAH1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LAH1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LAH1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAN1_SCHPO | ran1 | physical | 14665462 | |
PCR1_SCHPO | pcr1 | genetic | 22160596 | |
TOR1_SCHPO | tor1 | genetic | 22160596 | |
TSC1_SCHPO | tsc1 | genetic | 22160596 | |
XPOT_SCHPO | los1 | genetic | 22160596 | |
RAN1_SCHPO | ran1 | genetic | 14665462 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...