UniProt ID | PCR1_SCHPO | |
---|---|---|
UniProt AC | Q09926 | |
Protein Name | Transcription factor pcr1 | |
Gene Name | pcr1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 171 | |
Subcellular Localization | Nucleus . | |
Protein Description | Involved in regulation of gene expression for sexual development. Binds and activates meiotic recombination hot spot ade6-M26.. | |
Protein Sequence | MTAKKKEVDDEKRRRILERNRIAASKFRQKKKEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLKSQLLAHQGCQCSVKIRSVLTDFQTAHNALHSQHMAYRPVQPPPGDNMLESVVSVSPTQMHPSLQGLPPNQHPQMPPSSQQPNSDDVQQHMFSAAGLPRSLGGPI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PCR1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCR1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCR1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCR1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGO1_SCHPO | ago1 | genetic | 15218150 | |
DCR1_SCHPO | dcr1 | genetic | 15218150 | |
RDP1L_SCHPO | deb1 | genetic | 15218150 | |
CHP1_SCHPO | chp1 | genetic | 15475954 | |
TAS3_SCHPO | tas3 | genetic | 15475954 | |
DCR1_SCHPO | dcr1 | genetic | 15475954 | |
YAWC_SCHPO | SPAC3F10.12c | physical | 26771498 | |
ATF1_SCHPO | atf1 | physical | 26771498 | |
AGO1_SCHPO | ago1 | genetic | 26443059 | |
SGF73_SCHPO | sgf73 | genetic | 26443059 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...