PCR1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PCR1_SCHPO
• UniProt AC: Q09926
• Protein Name: Transcription factor pcr1
• Gene Name: pcr1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 171
• Subcellular Localization: Nucleus .
• Protein Description: Involved in regulation of gene expression for sexual development. Binds and activates meiotic recombination hot spot ade6-M26..
• Protein Sequence: MTAKKKEVDDEKRRRILERNRIAASKFRQKKKEWIKELEQTANAAFEQSKRLQLLLSQLQQEAFRLKSQLLAHQGCQCSVKIRSVLTDFQTAHNALHSQHMAYRPVQPPPGDNMLESVVSVSPTQMHPSLQGLPPNQHPQMPPSSQQPNSDDVQQHMFSAAGLPRSLGGPI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of PCR1_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PCR1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PCR1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PCR1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGO1_SCHPO	ago1	genetic	15218150
DCR1_SCHPO	dcr1	genetic	15218150
RDP1L_SCHPO	deb1	genetic	15218150
CHP1_SCHPO	chp1	genetic	15475954
TAS3_SCHPO	tas3	genetic	15475954
DCR1_SCHPO	dcr1	genetic	15475954
YAWC_SCHPO	SPAC3F10.12c	physical	26771498
ATF1_SCHPO	atf1	physical	26771498
AGO1_SCHPO	ago1	genetic	26443059
SGF73_SCHPO	sgf73	genetic	26443059

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.