| UniProt ID | RDP1L_SCHPO | |
|---|---|---|
| UniProt AC | O13862 | |
| Protein Name | Transcriptional activator protein rdp1 | |
| Gene Name | rdp1 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 478 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Acts as a DNA damage-response activator of rhp51. Binds to part of the DNA damage-responsive element (DRE), (5'-NG[GT]T[GA]-3').. | |
| Protein Sequence | MSEHSPEASSTYAQVTSNDELSSNKIYMNADQNNSRKKEMDGSLQNNGGRLQNVNPLGGNESMSAVATSAASSLPTAENGVSLNAASPTIHSNTPTVVSHPVMSGSELKGEESHNSPGTLNGTSVANASKQPNMPNATFRCDKCDMMFVKQSGLTNHKRTYHQVETVVIIGHRRYVWRRNENGRFQCVCGRQNWRRPVNFASHAKQCPSFLAMDPNNIPPEINKVSPHDDLRPLSDSRRRARRPHPSDTIPPGASMARSDPSQVPESNPSAAAAVAAAAVAAAANLTNGVNPPEVPRNLNSSLVDAAESLANVSQQQHHRHPFARQPDYSAHSIPRTAAPYAPSMNMFAQNGPNTSLLPTAMPSDVSISSSLQQQPIHPSYDSRFSKAPQGTDALAALGYGTPSSAATLCPLYRDTPAAIVSEKLHLRLANLRIAYCEDCREFISLNAALDHRRSHHQQNITGDLVHVYSDFLDFQNC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MSEHSPEAS ------CCCCCCCHH | 24763107 | ||
| 5 | Phosphorylation | ---MSEHSPEASSTY ---CCCCCCCHHCCC | 29996109 | ||
| 113 | Phosphorylation | SELKGEESHNSPGTL CCCCCCCCCCCCCCC | 24763107 | ||
| 116 | Phosphorylation | KGEESHNSPGTLNGT CCCCCCCCCCCCCCC | 29996109 | ||
| 119 | Phosphorylation | ESHNSPGTLNGTSVA CCCCCCCCCCCCCCC | 21712547 | ||
| 226 | Phosphorylation | PPEINKVSPHDDLRP CCCHHCCCCCCCCCC | 29996109 | ||
| 329 | Phosphorylation | PFARQPDYSAHSIPR CCCCCCCCCCCCCCC | 25720772 | ||
| 333 | Phosphorylation | QPDYSAHSIPRTAAP CCCCCCCCCCCCCCC | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RDP1L_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RDP1L_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RDP1L_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AGO1_SCHPO | ago1 | physical | 16734665 | |
| HRR1_SCHPO | hrr1 | physical | 15607976 | |
| CID12_SCHPO | cid12 | physical | 15607976 | |
| CHP1_SCHPO | chp1 | physical | 15607976 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...