| UniProt ID | SGF73_SCHPO | |
|---|---|---|
| UniProt AC | O94397 | |
| Protein Name | SAGA-associated factor 73 | |
| Gene Name | sgf73 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 344 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Functions as component of the transcription regulatory histone acetylation (HAT) complex SAGA. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction and promoter selectivity, interaction with transcription activators, and chromatin modification through histone acetylation and deubiquitination. SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). Sgf11 is involved in transcriptional regulation of a subset of SAGA-regulated genes and is required for histone H2B deubiquitination (By similarity).. | |
| Protein Sequence | MLTEQQTLELFPENWERNEQVLLKYPDGLPKDVLADQRVDNTESQVKDEITSNITNQTQILLPADSFPQYGSYPNNSELDYVVCTKCDRPFLSEYIEDHHSSCNGIKPPKPQFEPVANSQVLNKDVNNGNNAPIKNGVKSTAKGSAGNHEKNSVNGQKNPEMPPKRRKTEENKKPTKSALPKKEASKKKNPKVKGPVDVEKQCGVLLPNGQMCARSLTCKTHSMSSKRAVPGRSQPYDVLLAACQKKNQVKIQRQILETAKESEDNQHQAPVDSDEEVSFIMNVLQKSGNQPLEQKVFLPVKRRHSYFRTRELIAAAFRHGEQGMQVTGTILGRVIPFSARQPL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 223 | Phosphorylation | SLTCKTHSMSSKRAV ECCEECCCCCCCCCC | 26.12 | 25720772 | |
| 225 | Phosphorylation | TCKTHSMSSKRAVPG CEECCCCCCCCCCCC | 35.40 | 25720772 | |
| 226 | Phosphorylation | CKTHSMSSKRAVPGR EECCCCCCCCCCCCC | 19.95 | 25720772 | |
| 263 | Phosphorylation | ILETAKESEDNQHQA HHHHHHHCCCCCCCC | 49.93 | 21712547 | |
| 274 | Phosphorylation | QHQAPVDSDEEVSFI CCCCCCCCHHHHHHH | 47.35 | 24763107 | |
| 279 | Phosphorylation | VDSDEEVSFIMNVLQ CCCHHHHHHHHHHHH | 16.60 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGF73_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGF73_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGF73_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
