dbPTM

YDED_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YDED_SCHPO
UniProt AC	Q10446
Protein Name	Uncharacterized protein C12B10.13
Gene Name	SPAC12B10.13
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	240
Subcellular Localization
Protein Description
Protein Sequence	MVGTSSLDISMSGSSSSDAEQWEKQTKSVHIDNSDVNSLILDYLVIQGDEEAAKTFAEEAQITDYYIPPYVKERLEICELIKSGSINSAICKLNELEPEILDTNSELLFELLRLRLLELIREVVEEKDTSDLAVERCLNFAHENLAPLAPSNQKFLNSLELTMSLLCFPPSSYSPALKNVLNYSQRERVANLANVSILKSQGLSNESRLLSLVNFERWCEKEAQRNSIEVQKFVPKASIK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	SSLDISMSGSSSSDA CCCEEECCCCCCCCH	28.82	29996109
14	Phosphorylation	LDISMSGSSSSDAEQ CEEECCCCCCCCHHH	21.53	29996109
15	Phosphorylation	DISMSGSSSSDAEQW EEECCCCCCCCHHHH	37.07	29996109
227	Phosphorylation	EKEAQRNSIEVQKFV HHHHHHCCCCHHHCC	23.47	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YDED_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YDED_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YDED_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PNK1_SCHPO	pnk1	genetic	18818364
NGG1_SCHPO	ngg1	genetic	18818364
PLMT_SCHPO	cho1	genetic	18818364
DCR1_SCHPO	dcr1	genetic	18818364
ALG12_SCHPO	alg12	genetic	22681890
SDS23_SCHPO	sds23	genetic	22681890
UPP2_SCHPO	SPAC1399.04c	genetic	22681890
ARP6_SCHPO	arp6	genetic	22681890
VPS1_SCHPO	vps1	genetic	22681890
YN8E_SCHPO	SPBP35G2.14	genetic	22681890
DEP1_SCHPO	dep1	genetic	22681890
NEM1_SCHPO	nem1	genetic	22681890
AATC_SCHPO	SPAC10F6.13c	genetic	22681890
ALF1_SCHPO	alf1	genetic	22681890
SWD1_SCHPO	swd1	genetic	22681890
PO152_SCHPO	pom152	genetic	22681890
POM1_SCHPO	pom1	genetic	22681890
FT105_SCHPO	ftp105	genetic	22681890
PPR8_SCHPO	ppr8	genetic	22681890
HMT2_SCHPO	hmt2	genetic	22681890
ASH2_SCHPO	ash2	genetic	22681890
POF9_SCHPO	pof9	genetic	22681890
HIBCH_SCHPO	snr1	genetic	22681890
YOI9_SCHPO	SPBC1778.09	genetic	22681890
YE98_SCHPO	erp2	genetic	22681890
YO48_SCHPO	SPBC36B7.08c	genetic	22681890
AROG_SCHPO	SPAP8A3.07c	genetic	22681890
YIDH_SCHPO	SPAC227.17c	genetic	22681890
PFL9_SCHPO	pfl9	genetic	22681890
YOW5_SCHPO	SPBC1861.05	genetic	22681890
SET1_SCHPO	set1	genetic	22681890
ASK1_SCHPO	ask1	genetic	22681890
YI47_SCHPO	SPBC1348.07	genetic	22681890
YA4C_SCHPO	SPAC31A2.12	genetic	22681890
YCPE_SCHPO	trp663	genetic	22681890
YLY5_SCHPO	SPAC186.05c	genetic	22681890
SGF29_SCHPO	sgf29	genetic	22681890
MED4_SCHPO	pmc4	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YDED_SCHPO

Related Literatures of Post-Translational Modification