MED4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MED4_SCHPO
• UniProt AC: Q9Y821
• Protein Name: Mediator of RNA polymerase II transcription subunit 4
• Gene Name: med4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 239
• Subcellular Localization: Nucleus.
• Protein Description: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors..
• Protein Sequence: MEYQRAIDSIEECLNKQLRLSSEKVDQYVLIENWTSLVGHLKTLHSLISNYTNGRELQNEISSLLKQDKELDLQIQDCMREMTSIYDTHLPKTVSGRKRQKVNAETLLDYGRKLSKFSSAPPGYNPETGQDAKAPVHYPWPSEDQMRKTLLFQFSTSMVPNLSATASQLFSEQPPKTNEPTETETEIDANKAVEEKTKMNYPASPTFTTQEENKEVESPANKDVFAGFDLFDPEMEEDF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
201	Phosphorylation	EEKTKMNYPASPTFT HHHHCCCCCCCCCCC	9.18	29996109
204	Phosphorylation	TKMNYPASPTFTTQE HCCCCCCCCCCCCHH	21.70	28889911
206	Phosphorylation	MNYPASPTFTTQEEN CCCCCCCCCCCHHHH	30.99	28889911
208	Phosphorylation	YPASPTFTTQEENKE CCCCCCCCCHHHHCC	30.01	29996109
218	Phosphorylation	EENKEVESPANKDVF HHHCCCCCCCCCCCC	34.19	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MED4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MED4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MED4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COG2_SCHPO	cog2	physical	26771498
RAD21_SCHPO	rad21	physical	26771498
VATD_SCHPO	vma8	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Phosphoproteome analysis of fission yeast.";
Wilson-Grady J.T., Villen J., Gygi S.P.;
J. Proteome Res. 7:1088-1097(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-204 AND SER-218, ANDMASS SPECTROMETRY.
PubMed: 18257517