COG2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: COG2_SCHPO
• UniProt AC: O59705
• Protein Name: Conserved oligomeric Golgi complex subunit 2
• Gene Name: cog2
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 191
• Subcellular Localization: Golgi apparatus membrane ; Peripheral membrane protein ; Cytoplasmic side . Nucleus .
• Protein Description: Required for normal Golgi morphology and function..
• Protein Sequence: MTEKDADSGSDLVDAFLSDAYLNTEELRKDGPFSPDEFLVSKRFLGLDGLVNELSRLFEQVNNELMLLVKDNYQDFVHLGSRMKSGNTKVSTLISSIHRSEEQLKNSKQSLIGHSTEIQNNLKHKQDVENEKLIASNLLLLDQILKFLKSNDSSHPLWLESLNNAQRLCDTYKDHPWVQSISPTLINYIKH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
8	Phosphorylation	MTEKDADSGSDLVDA CCHHCCCCCCHHHHH	41.75	24763107
10	Phosphorylation	EKDADSGSDLVDAFL HHCCCCCCHHHHHHH	31.55	21712547
34	Phosphorylation	LRKDGPFSPDEFLVS HHHCCCCCHHHHHHC	34.28	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of COG2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of COG2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of COG2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
COG4_SCHPO	cog4	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.