NEM1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NEM1_SCHPO
• UniProt AC: O59718
• Protein Name: Nuclear envelope morphology protein 1
• Gene Name: nem1
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 476
• Subcellular Localization: Endoplasmic reticulum membrane ; Single-pass membrane protein . Nucleus membrane; Single-pass membrane protein.
• Protein Description: Catalytic component of the nem1-spo7 complex which acts as a phosphatase and may be required for proper nuclear membrane morphology..
• Protein Sequence: MNSIARLSDEINKAILATPLDDDEADKEKLANARGRASSATLRHYNRRRSSYSASSLSSLSSKPTEKEVPTRNEKPKHANIMRVVVYWIRVFLKRIYTFFVHSARVFLYHFLNEEKEFTLASFFWGLCRFVFFPVLLSYKRREMLPPQPSVRRPRFYSSYSYPSSHQDPAYSSFKRHRSSNSYSSSSNGNHVRFQPSIAEEEISFNSFSNSLNSEEDVCVSPMKPKEVSLMGKANSNRSGHSHQPQSTQFSPPANDNISKLPSSFTIVNDPLKSPSSSRLRIRNITLCADKIPRPLLNSKLPRKTLVLDLDETLIHSVSRGSRTTSGQPIEVHVPGEHPILYYIHKRPHLDYFLSNVSQWFRLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFVKDISICNIHLSRIMIIDNSPASYNAHKENAIPIEGWISDPSDVDLLNLLSFLHALQYVHDVRDLLGLRLAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
50	Phosphorylation	RHYNRRRSSYSASSL HHHHHCCCCCCHHHH	31.64	29996109
51	Phosphorylation	HYNRRRSSYSASSLS HHHHCCCCCCHHHHH	22.69	29996109
237	N-linked_Glycosylation	LMGKANSNRSGHSHQ ECCCCCCCCCCCCCC	41.78	-
257	N-linked_Glycosylation	FSPPANDNISKLPSS CCCCCCCCHHCCCCC	39.99	-
274	Phosphorylation	IVNDPLKSPSSSRLR EECCCCCCCCCCCEE	37.38	29996109
276	Phosphorylation	NDPLKSPSSSRLRIR CCCCCCCCCCCEEEE	48.30	29996109
278	Phosphorylation	PLKSPSSSRLRIRNI CCCCCCCCCEEEEEE	39.41	29996109
284	N-linked_Glycosylation	SSRLRIRNITLCADK CCCEEEEEEEEECCC	29.26	-
356	N-linked_Glycosylation	HLDYFLSNVSQWFRL CHHHHHHCHHHHHHH	39.34	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NEM1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NEM1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NEM1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YEG5_SCHPO	mga2	genetic	19547744

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.