UniProt ID | NEM1_SCHPO | |
---|---|---|
UniProt AC | O59718 | |
Protein Name | Nuclear envelope morphology protein 1 | |
Gene Name | nem1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 476 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . Nucleus membrane Single-pass membrane protein. |
|
Protein Description | Catalytic component of the nem1-spo7 complex which acts as a phosphatase and may be required for proper nuclear membrane morphology.. | |
Protein Sequence | MNSIARLSDEINKAILATPLDDDEADKEKLANARGRASSATLRHYNRRRSSYSASSLSSLSSKPTEKEVPTRNEKPKHANIMRVVVYWIRVFLKRIYTFFVHSARVFLYHFLNEEKEFTLASFFWGLCRFVFFPVLLSYKRREMLPPQPSVRRPRFYSSYSYPSSHQDPAYSSFKRHRSSNSYSSSSNGNHVRFQPSIAEEEISFNSFSNSLNSEEDVCVSPMKPKEVSLMGKANSNRSGHSHQPQSTQFSPPANDNISKLPSSFTIVNDPLKSPSSSRLRIRNITLCADKIPRPLLNSKLPRKTLVLDLDETLIHSVSRGSRTTSGQPIEVHVPGEHPILYYIHKRPHLDYFLSNVSQWFRLILFTASVQPYADPIIDYLERDKKIFAKRYYRQHCALVDSSFVKDISICNIHLSRIMIIDNSPASYNAHKENAIPIEGWISDPSDVDLLNLLSFLHALQYVHDVRDLLGLRLAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Phosphorylation | RHYNRRRSSYSASSL HHHHHCCCCCCHHHH | 31.64 | 29996109 | |
51 | Phosphorylation | HYNRRRSSYSASSLS HHHHCCCCCCHHHHH | 22.69 | 29996109 | |
237 | N-linked_Glycosylation | LMGKANSNRSGHSHQ ECCCCCCCCCCCCCC | 41.78 | - | |
257 | N-linked_Glycosylation | FSPPANDNISKLPSS CCCCCCCCHHCCCCC | 39.99 | - | |
274 | Phosphorylation | IVNDPLKSPSSSRLR EECCCCCCCCCCCEE | 37.38 | 29996109 | |
276 | Phosphorylation | NDPLKSPSSSRLRIR CCCCCCCCCCCEEEE | 48.30 | 29996109 | |
278 | Phosphorylation | PLKSPSSSRLRIRNI CCCCCCCCCEEEEEE | 39.41 | 29996109 | |
284 | N-linked_Glycosylation | SSRLRIRNITLCADK CCCEEEEEEEEECCC | 29.26 | - | |
356 | N-linked_Glycosylation | HLDYFLSNVSQWFRL CHHHHHHCHHHHHHH | 39.34 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NEM1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NEM1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NEM1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YEG5_SCHPO | mga2 | genetic | 19547744 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...