| UniProt ID | SGF29_SCHPO | |
|---|---|---|
| UniProt AC | Q9USW9 | |
| Protein Name | SAGA-associated factor 29 | |
| Gene Name | sgf29 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 244 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Chromatin reader component of the transcription regulatory histone acetylation (HAT) complex SAGA. [PubMed: 21642955] | |
| Protein Sequence | MVRPINAEEDVTSMWVKFHESLNPIRSSLIKQEECYKTVDGDDNPIEERIKACDAGIQTSEEQKKELEHTMQSLEMIINVLEKANEKPVITNSPLTRSRRNRGTSFTANTVTFTPGMSVAFKLPYTRHNEGGDWIQCIIIKVTGEGAKQRFEVQDPEPDDDGNAGQIYKTTANHLIQIPAKGTPLPPISPKTNVLARYPETTTFYRAEVIRTLPDGSCKLRFEGEEEVGKETVVERHLVLEYNG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 91 | Phosphorylation | ANEKPVITNSPLTRS HCCCCCCCCCCCCCC | 29996109 | ||
| 93 | Phosphorylation | EKPVITNSPLTRSRR CCCCCCCCCCCCCCC | 28889911 | ||
| 96 | Phosphorylation | VITNSPLTRSRRNRG CCCCCCCCCCCCCCC | 29996109 | ||
| 104 | Phosphorylation | RSRRNRGTSFTANTV CCCCCCCCCCEECEE | 25720772 | ||
| 105 | Phosphorylation | SRRNRGTSFTANTVT CCCCCCCCCEECEEE | 25720772 | ||
| 107 | Phosphorylation | RNRGTSFTANTVTFT CCCCCCCEECEEEEC | 25720772 | ||
| 110 | Phosphorylation | GTSFTANTVTFTPGM CCCCEECEEEECCCC | 25720772 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SGF29_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SGF29_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SGF29_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
