YKEA_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YKEA_SCHPO
• UniProt AC: Q9UTG5
• Protein Name: Uncharacterized protein C1805.10
• Gene Name: SPAC1805.10
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 527
• Protein Sequence: MVLVEHFCIHRCTPDGVIEMLWMYQSELMGNKQPILNKDEMAANNPELEALKNQIALFHGMYGFSVETKDILKEQPTDSKSTTSSAPKNSPFSLLESYDCLQVDTATVQKVLIKRPEGCRELHSCNVLMNNDEKNTLSLTPSIFLSVMKPCPKTSVLVTTVAALWEQFNIFHGSYLFDEIEKKSSFEIIDRWWTSVLSPLECGGYLLKSLSVLPVLHSLDDPLVKKMNDVIRKEDGTMGSLILFTKSGQPRLLSLQGLRLKPEFRNLLSYYCSHNYQHLIENESADINIAHRPLTTLFSDTDSNLAITNEVGEMTLRIFCLKKKSNKRLLAILWKLGQTSSEEVSNAFTNYIIGLAPLSQSVFDSQASTGFNFKIQKRVETELDMFWYIVANCTTGLAVVNTDFPLNDAHHLWNHLENLCNNQSFNSCQLQKITRGYWISLQQKEYNSRIYVDTVADQSQTYTPTRRFTKQGSQGDFNAIHSRKVPVTHTFTYILISKTNRWNSLHDTKAKIQRFIDQFDLTPTLYD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
473	Phosphorylation	RRFTKQGSQGDFNAI CCCCCCCCCCCCCHH	28.61	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YKEA_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YKEA_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YKEA_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YKEA_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.