UniProt ID | YBW4_SCHPO | |
---|---|---|
UniProt AC | O94662 | |
Protein Name | Uncharacterized protein C651.04 | |
Gene Name | SPBC651.04 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 237 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSSAELGKLHIYASPEQWEKWSPRWKSIVFRTQYESIFKNPKHHGEKKPFHCLFKLAGTMKSISLSHLDIPEHRMSNAVAFPITTSTTPMQLDVTLQFRGHKIPLVVGEASVSLEDIFTHGTVESVIPLFMKKRHPEAYLRIKLVYTRSKRKSARKHKVPSSFHRFSGRRGLGIHYNHSGSQSSLITLPLPQKQPDFLRMNNDTNELKTNGFEPIRFVFTTTPYSPASFEVPKTLKT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YBW4_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBW4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBW4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBW4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
YG58_SCHPO | SPBC56F2.08c | genetic | 22681890 | |
HRP3_SCHPO | hrp3 | genetic | 22681890 | |
YIP4_SCHPO | SPAC644.13c | genetic | 22681890 | |
FLP1_SCHPO | clp1 | genetic | 22681890 | |
PCK1_SCHPO | pck1 | genetic | 22681890 | |
VTS1_SCHPO | SPBC13E7.03c | genetic | 22681890 | |
6PGL_SCHPO | SPCC16C4.10 | genetic | 22681890 | |
YAC5_SCHPO | cph1 | genetic | 22681890 | |
ALF1_SCHPO | alf1 | genetic | 22681890 | |
GCN5_SCHPO | gcn5 | genetic | 22681890 | |
CSN1_SCHPO | csn1 | genetic | 22681890 | |
ARP42_SCHPO | arp42 | genetic | 22681890 | |
SPN4_SCHPO | spn4 | genetic | 22681890 | |
SSN3_SCHPO | srb10 | genetic | 22681890 | |
YEEB_SCHPO | SPAC19A8.11c | genetic | 22681890 | |
PMP1_SCHPO | pmp1 | genetic | 22681890 | |
YF75_SCHPO | spa2 | genetic | 22681890 | |
SET1_SCHPO | set1 | genetic | 22681890 | |
PTPA1_SCHPO | ypa1 | genetic | 22681890 | |
DAD2_SCHPO | dad2 | genetic | 22681890 | |
SPN1_SCHPO | spn1 | genetic | 22681890 | |
CSK1_SCHPO | csk1 | genetic | 22681890 | |
SGF29_SCHPO | sgf29 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...