SPN4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPN4_SCHPO
• UniProt AC: P48009
• Protein Name: Septin homolog spn4
• Gene Name: spn4
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 380
• Subcellular Localization: Cytoplasm, cell cortex . Localizes to the medial ring at the cell cortex of dividing cells.
• Protein Description: Plays a role in the cell cycle. Involved in a late stage of septum formation leading to the separation of the daughter cells..
• Protein Sequence: MNEEETNFVGIADLPNQRHKIVSRNGVAFTLMLCGESGLGKTTFCNTLFSTTIKSHMGPEKVRAKHAEKTVEIEITKAELEEKNFHLRLTVIDTPGFGDFINNSGCWESVVEFIEDQHESYMRQDQQPDRRKIIDMRIHACLYFLRPVRNGVRPMDLEAMKHISKRVNLIPVIAKADMYTRRDLALYKTRISQVLEYHQVNVYKPNMDEGDPVFHRQIQGIINCMPFAIVGSEDDIRTPDGRVVKGREYPWGIVEIENEEHCDFKQLRNILIRSCMLDLIQTTEEKLYEQYRQEQMKVRQYGEPKLRTIDNAKFKEEEENLRKRFTEQVRVEETRFRQWEQRLIAERDSLNKDLEAQHVQIKQIELEIERLKAATSSRKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SPN4_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPN4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPN4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPN4_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SPN1_SCHPO	spn1	physical	15385632
SPN2_SCHPO	spn2	physical	15385632
SPN4_SCHPO	spn4	physical	15385632
MLR4_SCHPO	cdc4	genetic	20739711
ART1_SCHPO	art1	genetic	20739711
RGF3_SCHPO	rgf3	genetic	20739711
SPT20_SCHPO	spt20	physical	25015293

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.