UniProt ID | SPN2_SCHPO | |
---|---|---|
UniProt AC | Q09116 | |
Protein Name | Septin homolog spn2 | |
Gene Name | spn2 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 331 | |
Subcellular Localization |
Cytoplasm, cell cortex. Forespore membrane Peripheral membrane protein. Localizes to the medial ring at the cell cortex of dividing cells. The sporulation-specific septin complex associates to the forespore membrane and forms partial or complete rin |
|
Protein Description | Plays a role in the cell cycle. Involved in a late stage of septum formation leading to the separation of the daughter cells. Involved in the correct orientation of forespore membrane extension during sporulation. Binds phosphatidylinositol 4-phosphate.. | |
Protein Sequence | MEVPSAVTLNNYVGFDSITSQINRKLIRRGFQFNVMVVGPSGSGKSTLINTLFSAHLMDSKGRLDYQAPYRQTTEIHVTSQVVRENRVQLQLNLIDTPGYGDQINNDKCWEPIIKYIRDQHSSYLRRELNSHREKRLQDTRVHCCLFFIRPTGHSLRPIDIAVLKRLTEVVNVVPVIAKSDSLTLEERAAFKQQIREEFVKHDINLYPYDSDDADEEEINLNAAVRNLIPFAVVGSEKAIIVDGRPIRGRQNRWGVVNVDDENHCEFVFLRNFLMRTHLQDLIETTSYYHYEKFRFKQLSSLKEQSSLATRMGSPAPVYPSEPHLHTATAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
306 | Phosphorylation | LSSLKEQSSLATRMG HHHHHHHHHHHHHCC | 28.54 | 24763107 | |
307 | Phosphorylation | SSLKEQSSLATRMGS HHHHHHHHHHHHCCC | 23.01 | 24763107 | |
314 | Phosphorylation | SLATRMGSPAPVYPS HHHHHCCCCCCCCCC | 14.46 | 28889911 | |
319 | Phosphorylation | MGSPAPVYPSEPHLH CCCCCCCCCCCCCCC | 10.44 | 28889911 | |
321 | Phosphorylation | SPAPVYPSEPHLHTA CCCCCCCCCCCCCCC | 46.18 | 21712547 | |
329 | Phosphorylation | EPHLHTATAQ----- CCCCCCCCCC----- | 27.09 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPN2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPN2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPN2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SPN1_SCHPO | spn1 | physical | 15385632 | |
SPN4_SCHPO | spn4 | physical | 15385632 | |
SPN2_SCHPO | spn2 | physical | 15385632 | |
SPN7_SCHPO | spn7 | physical | 20123972 | |
MEU14_SCHPO | meu14 | genetic | 20123972 | |
HPC2_SCHPO | hip4 | genetic | 18818364 | |
2AD1_SCHPO | par1 | genetic | 18818364 | |
LUB1_SCHPO | lub1 | genetic | 22681890 | |
TUP11_SCHPO | tup11 | genetic | 22681890 | |
CTBL1_SCHPO | SPAC1952.06c | genetic | 22681890 | |
CLR4_SCHPO | clr4 | genetic | 22681890 | |
RAF1_SCHPO | raf1 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
YAM5_SCHPO | mso1 | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
YA99_SCHPO | SPAC13G6.09 | genetic | 22681890 | |
TBA2_SCHPO | atb2 | genetic | 22681890 | |
SPT20_SCHPO | spt20 | physical | 25015293 | |
SPT20_SCHPO | spt20 | genetic | 25015293 | |
SPN4_SCHPO | spn4 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...