UniProt ID | YAM5_SCHPO | |
---|---|---|
UniProt AC | Q10060 | |
Protein Name | Uncharacterized protein C1F5.05c | |
Gene Name | SPAC1F5.05c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 151 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MWSKLSISSKINRIRDPESDNTIEDTHVARVMRKYYMDKIGTLPEWLRPPGWQPPVNTGPTSPVSINASNAAPSNLKASYIPANPRRLSSSTSSASSPPLRRLPSVQHSTFDDLFEGVGSLQKSPSTTKPLSSTPSGSLLRSKFDHTRKKF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | Phosphorylation | GWQPPVNTGPTSPVS CCCCCCCCCCCCCCE | 44.78 | 29996109 | |
62 | Phosphorylation | PVNTGPTSPVSINAS CCCCCCCCCCEECCC | 26.83 | 27738172 | |
89 | Phosphorylation | PANPRRLSSSTSSAS CCCHHCCCCCCCCCC | 22.04 | 29996109 | |
90 | Phosphorylation | ANPRRLSSSTSSASS CCHHCCCCCCCCCCC | 42.08 | 29996109 | |
92 | Phosphorylation | PRRLSSSTSSASSPP HHCCCCCCCCCCCCC | 28.75 | 25720772 | |
93 | Phosphorylation | RRLSSSTSSASSPPL HCCCCCCCCCCCCCH | 26.34 | 29996109 | |
94 | Phosphorylation | RLSSSTSSASSPPLR CCCCCCCCCCCCCHH | 32.05 | 25720772 | |
105 | Phosphorylation | PPLRRLPSVQHSTFD CCHHCCCCCCCCCHH | 38.71 | 29996109 | |
109 | Phosphorylation | RLPSVQHSTFDDLFE CCCCCCCCCHHHHHH | 17.43 | 29996109 | |
110 | Phosphorylation | LPSVQHSTFDDLFEG CCCCCCCCHHHHHHC | 29.03 | 29996109 | |
124 | Phosphorylation | GVGSLQKSPSTTKPL CCCCCCCCCCCCCCC | 15.89 | 21712547 | |
126 | Phosphorylation | GSLQKSPSTTKPLSS CCCCCCCCCCCCCCC | 56.66 | 29996109 | |
127 | Phosphorylation | SLQKSPSTTKPLSST CCCCCCCCCCCCCCC | 42.07 | 29996109 | |
128 | Phosphorylation | LQKSPSTTKPLSSTP CCCCCCCCCCCCCCC | 34.69 | 29996109 | |
132 | Phosphorylation | PSTTKPLSSTPSGSL CCCCCCCCCCCCCHH | 40.47 | 21712547 | |
133 | Phosphorylation | STTKPLSSTPSGSLL CCCCCCCCCCCCHHH | 52.61 | 21712547 | |
134 | Phosphorylation | TTKPLSSTPSGSLLR CCCCCCCCCCCHHHH | 20.35 | 21712547 | |
136 | Phosphorylation | KPLSSTPSGSLLRSK CCCCCCCCCHHHHHH | 40.89 | 24763107 | |
138 | Phosphorylation | LSSTPSGSLLRSKFD CCCCCCCHHHHHHCC | 28.68 | 21712547 | |
142 | Phosphorylation | PSGSLLRSKFDHTRK CCCHHHHHHCCCCCC | 37.33 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YAM5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAM5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAM5_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YAM5_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...