UniProt ID | MLR4_SCHPO | |
---|---|---|
UniProt AC | Q09196 | |
Protein Name | Myosin regulatory light chain cdc4 | |
Gene Name | cdc4 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 141 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Involved in cytokinesis. Required for the formation and function of the contractile ring.. | |
Protein Sequence | MSTDDSPYKQAFSLFDRHGTGRIPKTSIGDLLRACGQNPTLAEITEIESTLPAEVDMEQFLQVLNRPNGFDMPGDPEEFVKGFQVFDKDATGMIGVGELRYVLTSLGEKLSNEEMDELLKGVPVKDGMVNYHDFVQMILAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MLR4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MLR4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MLR4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYO2_SCHPO | myo2 | genetic | 10769212 | |
IMP2_SCHPO | imp2 | genetic | 9786952 | |
HSP9_SCHPO | hsp9 | genetic | 8654972 | |
ACT_SCHPO | act1 | genetic | 10371213 | |
MYO2_SCHPO | myo2 | physical | 10769212 | |
MYO3_SCHPO | myp2 | physical | 10769212 | |
MYO2_SCHPO | myo2 | physical | 11942609 | |
MYO2_SCHPO | myo2 | physical | 11087749 | |
MYO2_SCHPO | myo2 | physical | 10022828 | |
MYO3_SCHPO | myp2 | genetic | 20739711 | |
SPN1_SCHPO | spn1 | genetic | 20739711 | |
MID1_SCHPO | mid1 | physical | 21422229 | |
MYO2_SCHPO | myo2 | physical | 21422229 | |
CAM2_SCHPO | cam2 | genetic | 21693583 | |
PIK1_SCHPO | pik1 | physical | 21693583 | |
MYO2_SCHPO | myo2 | physical | 21693583 | |
MID1_SCHPO | mid1 | physical | 22427686 | |
KIN1_SCHPO | kin1 | genetic | 23294323 | |
RNG2_SCHPO | rng2 | genetic | 23615450 | |
SND1_SCHPO | snd1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...