CAM2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CAM2_SCHPO
• UniProt AC: O14008
• Protein Name: Myosin 1 light chain cam2
• Gene Name: cam2 {ECO:0000312|EMBL:CAB10132.1}
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 143
• Subcellular Localization: Cytoplasm . Prospore membrane. Accumulates at the cell poles in interphase cells and at the medial septation site in post-mitotic cells, colocalizing with myo1 and F-actin patches. During the mating process, a single dot is detected a the tip of the
• Protein Description: Plays a role in meiosis and sporulation..
• Protein Sequence: MPASKEQTDEMKEAFVLYDIDKDGLIPTSHVGSVLRSLGINVTDAELAKLSNELGDAIDEKKFMSFVSNKLRETESEEEYIKAFRVFDKDNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEADPTNSGSFDYYDFVQRIMAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
65	Phosphorylation	IDEKKFMSFVSNKLR HCHHHHHHHHHHHHC	26.15	25720772
74	Phosphorylation	VSNKLRETESEEEYI HHHHHCCCCCHHHHH	38.08	25720772
76	Phosphorylation	NKLRETESEEEYIKA HHHCCCCCHHHHHHH	58.70	24763107
80	Phosphorylation	ETESEEEYIKAFRVF CCCCHHHHHHHHEEE	15.82	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CAM2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CAM2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CAM2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MYO1_SCHPO	myo1	physical	21693583
PIK1_SCHPO	pik1	physical	21693583

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.