UniProt ID | PMP1_SCHPO | |
---|---|---|
UniProt AC | O13453 | |
Protein Name | Tyrosine-protein phosphatase pmp1 | |
Gene Name | pmp1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 278 | |
Subcellular Localization | ||
Protein Description | Dual specificity phosphatase that dephosphorylates MAP kinase pmk1 on a Tyr. Has a role in chloride ion homeostasis by inactivating this pmk1 MAP kinase pathway.. | |
Protein Sequence | MSQKLPPLKIYTSQLPLVSHKNMLENEEEASHSQLFTPCPVPPSFPKASKPNSNQPYPNGPVCIYPPNIYLYAKPTMPIIQSFDVVINVAKEVLHPFRTDGRHYRDSKHNLDIQVFDHIEYVHIHWDHDTQFALELDKLVSFVAYNAMQLNKKVLINCQMGISRSACLMIAFIMKTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQIIRKNSSQGPYQSSSLKQSKRKSEGNLLFPEKPHSAQLPLVSPSTSESSMFTNLRRTRSSGSISNDAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
233 | Phosphorylation | LKQSKRKSEGNLLFP HHHHCCCCCCCCCCC | 55.56 | 24763107 | |
254 | Phosphorylation | QLPLVSPSTSESSMF CCCCCCCCCCCCHHC | 36.74 | 21712547 | |
262 | Phosphorylation | TSESSMFTNLRRTRS CCCCHHCCCCCCCCC | 25.38 | 27738172 | |
269 | Phosphorylation | TNLRRTRSSGSISND CCCCCCCCCCCCCCC | 38.14 | 24763107 | |
270 | Phosphorylation | NLRRTRSSGSISNDA CCCCCCCCCCCCCCC | 33.01 | 24763107 | |
272 | Phosphorylation | RRTRSSGSISNDAS- CCCCCCCCCCCCCC- | 25.45 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PMP1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PMP1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PMP1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...