dbPTM

PMP1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PMP1_SCHPO
UniProt AC	O13453
Protein Name	Tyrosine-protein phosphatase pmp1
Gene Name	pmp1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	278
Subcellular Localization
Protein Description	Dual specificity phosphatase that dephosphorylates MAP kinase pmk1 on a Tyr. Has a role in chloride ion homeostasis by inactivating this pmk1 MAP kinase pathway..
Protein Sequence	MSQKLPPLKIYTSQLPLVSHKNMLENEEEASHSQLFTPCPVPPSFPKASKPNSNQPYPNGPVCIYPPNIYLYAKPTMPIIQSFDVVINVAKEVLHPFRTDGRHYRDSKHNLDIQVFDHIEYVHIHWDHDTQFALELDKLVSFVAYNAMQLNKKVLINCQMGISRSACLMIAFIMKTLNLNVSDAYEYVKERSPWIGPNMSLIFQLSEYQQIIRKNSSQGPYQSSSLKQSKRKSEGNLLFPEKPHSAQLPLVSPSTSESSMFTNLRRTRSSGSISNDAS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
233	Phosphorylation	LKQSKRKSEGNLLFP HHHHCCCCCCCCCCC	55.56	24763107
254	Phosphorylation	QLPLVSPSTSESSMF CCCCCCCCCCCCHHC	36.74	21712547
262	Phosphorylation	TSESSMFTNLRRTRS CCCCHHCCCCCCCCC	25.38	27738172
269	Phosphorylation	TNLRRTRSSGSISND CCCCCCCCCCCCCCC	38.14	24763107
270	Phosphorylation	NLRRTRSSGSISNDA CCCCCCCCCCCCCCC	33.01	24763107
272	Phosphorylation	RRTRSSGSISNDAS- CCCCCCCCCCCCCC-	25.45	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PMP1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PMP1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PMP1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RNC1_SCHPO	rnc1	physical	12931193
SPM1_SCHPO	pmk1	physical	9427748
SPM1_SCHPO	pmk1	genetic	17881729
SKH1_SCHPO	pek1	genetic	12931193
KIN1_SCHPO	kin1	genetic	20624220
RSC4_SCHPO	rsc4	genetic	18818364
BDC1_SCHPO	bdc1	genetic	18818364
ASK1_SCHPO	ask1	genetic	18818364
NGG1_SCHPO	ngg1	genetic	18818364
YB3C_SCHPO	cay1	genetic	18818364
CSK2C_SCHPO	ckb2	genetic	18818364
MUB1_SCHPO	SPBC31F10.10c	genetic	18818364
2AD1_SCHPO	par1	genetic	18818364
JHD1_SCHPO	epe1	genetic	18818364
NOT2_SCHPO	not2	genetic	18818364
SWC5_SCHPO	swc5	genetic	18818364
PP2B_SCHPO	ppb1	genetic	9427748
CCH1_SCHPO	cch1	genetic	22681890
CSN3_SCHPO	csn3	genetic	22681890
FLP1_SCHPO	clp1	genetic	22681890
PCK1_SCHPO	pck1	genetic	22681890
ALG12_SCHPO	alg12	genetic	22681890
BDC1_SCHPO	bdc1	genetic	22681890
PYP1_SCHPO	pyp1	genetic	22681890
VPS1_SCHPO	vps1	genetic	22681890
YEN1_SCHPO	SPAC11G7.01	genetic	22681890
BST1_SCHPO	bst1	genetic	22681890
NEM1_SCHPO	nem1	genetic	22681890
SKB5_SCHPO	skb5	genetic	22681890
POP2_SCHPO	pop2	genetic	22681890
YGWH_SCHPO	gmh4	genetic	22681890
SWD1_SCHPO	swd1	genetic	22681890
MU113_SCHPO	mug113	genetic	22681890
GSK3_SCHPO	gsk3	genetic	22681890
ZRG17_SCHPO	zrg17	genetic	22681890
YMR1_SCHPO	ymr1	genetic	22681890
PSL1_SCHPO	psl1	genetic	22681890
YEEB_SCHPO	SPAC19A8.11c	genetic	22681890
DPEH1_SCHPO	SPAC3A11.10c	genetic	22681890
YE98_SCHPO	erp2	genetic	22681890
MUG20_SCHPO	mug20	genetic	22681890
PP2C3_SCHPO	ptc3	genetic	22681890
ALG5_SCHPO	alg5	genetic	22681890
AROG_SCHPO	SPAP8A3.07c	genetic	22681890
YF75_SCHPO	spa2	genetic	22681890
GAR2_SCHPO	gar2	genetic	22681890
YA7D_SCHPO	SPAC24H6.13	genetic	22681890
OMH1_SCHPO	omh1	genetic	22681890
GMA12_SCHPO	gma12	genetic	22681890
PTPA1_SCHPO	ypa1	genetic	22681890
ERD11_SCHPO	erd1	genetic	22681890
SHR3_SCHPO	psh3	genetic	22681890
TOM70_SCHPO	tom70	genetic	22681890
BU107_SCHPO	bun107	genetic	22681890
YBW4_SCHPO	SPBC651.04	genetic	22681890
VAC7_SCHPO	vac7	genetic	22681890
SVP26_SCHPO	SPCC1795.10c	genetic	22681890
YD22_SCHPO	SPAC56F8.02	genetic	22681890
MU123_SCHPO	mug123	genetic	22681890
VPS27_SCHPO	sst4	genetic	22681890
YG41_SCHPO	cxr1	genetic	22681890
YFE6_SCHPO	gmh5	genetic	22681890
RER1_SCHPO	rer1	genetic	22681890
EHS1_SCHPO	yam8	genetic	22681890
YCV2_SCHPO	SPCC777.02	genetic	22681890
RGA8_SCHPO	rga8	genetic	22681890
SPM1_SCHPO	pmk1	physical	24465549
PMP1_SCHPO	pmp1	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PMP1_SCHPO

Related Literatures of Post-Translational Modification