UniProt ID | PSL1_SCHPO | |
---|---|---|
UniProt AC | O42979 | |
Protein Name | PHO85 cyclin-like protein psl1 | |
Gene Name | psl1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 243 | |
Subcellular Localization | Cytoplasm . Nucleus . Localizes at the barrier septum. | |
Protein Description | Cyclin partner of the cyclin-dependent kinase (CDK) pef1 (PHO85 homolog).. | |
Protein Sequence | MSLAFTLLTSKDNTDEDEEHLELSSFNQEKLLEMISVFLSRLTRLNDSKQEATESDQIPLSPTSLKNPCLIFSAKNVPSISIQAYLTRILKYCPATNDVFLSVLIYLDRIVHHFHFTVFINSFNIHRFLIAGFTAASKFFSDVFYTNSRYAKVGGIPLHELNHLELSFFVFNDFNLFISLEDLQAYGDLLLSWYRQNGQNYNPTDVSCSIESPISHTPQQNQQDEQPRRPIMDRRLLSSHSIG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Phosphorylation | ESDQIPLSPTSLKNP CCCCCCCCCCCCCCC | 28889911 | ||
63 | Phosphorylation | DQIPLSPTSLKNPCL CCCCCCCCCCCCCEE | 28889911 | ||
238 | Phosphorylation | IMDRRLLSSHSIG-- CHHHHHHHHCCCC-- | 25720772 | ||
239 | Phosphorylation | MDRRLLSSHSIG--- HHHHHHHHCCCC--- | 25720772 | ||
241 | Phosphorylation | RRLLSSHSIG----- HHHHHHCCCC----- | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PSL1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PSL1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PSL1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...