UniProt ID | CWC16_SCHPO | |
---|---|---|
UniProt AC | O60141 | |
Protein Name | Protein saf4 | |
Gene Name | saf4 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 299 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in mRNA splicing.. | |
Protein Sequence | MQGFNMGKYIPPEGPNAKRKFDKLRNVIRFEMPFPVWCNNCENIIQQGTRFNAVKKEIGSYYTTKIWSFSLKCHLCSNPIDVHTDPKNTEYIVASGGRRKIEPQDINERPAKAENDEKVPSDAIEALETQLTQQKSEKHNSSVINFIYEKNERLWSDPFVSSQRLRKQFRERKKIEKKQEAKDLSLKNRAALDIDILPPSSSDKDKALLLLDNELGKNKFIRKLDYRRTLMPSSRTFSTFAKFAETSFAKKDPFARKFVPSEKLRSEQRKFPTENLKGEKILEDNSVSLVNYEVSDDEG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CWC16_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CWC16_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CWC16_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PROB_SCHPO | SPAC17H9.13c | genetic | 22681890 | |
LYS1_SCHPO | lys3 | genetic | 22681890 | |
EFTS_SCHPO | tsf1 | genetic | 22681890 | |
ARGJ_SCHPO | SPBC1271.14 | genetic | 22681890 | |
YGRG_SCHPO | SPBC365.16 | genetic | 22681890 | |
OTC_SCHPO | arg3 | genetic | 22681890 | |
YAS9_SCHPO | nab3 | genetic | 22681890 | |
NAGS_SCHPO | arg6 | genetic | 22681890 | |
FSV1_SCHPO | fsv1 | genetic | 22681890 | |
PSL1_SCHPO | psl1 | genetic | 22681890 | |
HOSM_SCHPO | lys4 | genetic | 22681890 | |
LYS4_SCHPO | lys2 | genetic | 22681890 | |
PUT2_SCHPO | SPBC24C6.04 | genetic | 22681890 | |
AROG_SCHPO | SPAP8A3.07c | genetic | 22681890 | |
AATM_SCHPO | SPBC725.01 | genetic | 22681890 | |
YCF8_SCHPO | SPCC1393.08 | genetic | 22681890 | |
RM01_SCHPO | SPAC1610.02c | genetic | 22681890 | |
YIU1_SCHPO | saf5 | genetic | 22681890 | |
ARG56_SCHPO | arg11 | genetic | 22681890 | |
SET1_SCHPO | set1 | genetic | 22681890 | |
TSR4_SCHPO | SPBC25H2.15 | genetic | 22681890 | |
PPK16_SCHPO | ppk16 | genetic | 22681890 | |
PIL2_SCHPO | pil2 | genetic | 22681890 | |
ASSY_SCHPO | arg12 | genetic | 22681890 | |
SEC6_SCHPO | sec6 | physical | 26771498 | |
NU211_SCHPO | nup211 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...