dbPTM

VAM7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	VAM7_SCHPO
UniProt AC	O74509
Protein Name	Vacuolar morphogenesis protein 7 homolog
Gene Name	SPCC594.06c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	341
Subcellular Localization	Vacuole .
Protein Description	Essential for proper morphogenesis of the vacuole. May exist as structural reinforcement on the surface of the vacuolar membrane and be required for maintenance against rupture by osmotic pressure (By similarity)..
Protein Sequence	MALKIKIPETSQSSDEYSRWTVYHIEVAFPNGGKHVVFRRFNEFVALDAQIRPNDYNSRLCKLPSKSWVSSTVTNEKLRESRRLALQAYVQCLSETPWIKMPVVKKFLNIKDESEDETQGQFLGPTDWIQVFQDCKRNLHMYRVDLMSGKSITIGVQTKNVYAIKSLMDNLSESLDKLELANALGPGEILRRKDMLEQLGSEFLSFKRLVKNANSPVAPPSASSQLNSSNPSSPFRPLSASTDKQSNTSLNRVLGKNRMPETQTTKKLDNVGLYNMQNQTMEDQDMQAESLLPIIQRQKELSKMINQEVVEQNSMLDELSNEAYANQKKLHRTRAGLRKLG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
228	Phosphorylation	SASSQLNSSNPSSPF CHHHHCCCCCCCCCC	39.83	21712547
229	Phosphorylation	ASSQLNSSNPSSPFR HHHHCCCCCCCCCCC	52.25	21712547
232	Phosphorylation	QLNSSNPSSPFRPLS HCCCCCCCCCCCCCC	55.69	29996109
233	Phosphorylation	LNSSNPSSPFRPLSA CCCCCCCCCCCCCCC	29.34	21712547
239	Phosphorylation	SSPFRPLSASTDKQS CCCCCCCCCCCCCCC	23.90	21712547
248	Phosphorylation	STDKQSNTSLNRVLG CCCCCCCCHHHHHHC	39.58	27738172
249	Phosphorylation	TDKQSNTSLNRVLGK CCCCCCCHHHHHHCC	28.09	27738172
262	Phosphorylation	GKNRMPETQTTKKLD CCCCCCCCCCCCCCC	25.91	27738172
264	Phosphorylation	NRMPETQTTKKLDNV CCCCCCCCCCCCCCC	48.26	27738172

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of VAM7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of VAM7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of VAM7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of VAM7_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of VAM7_SCHPO

Related Literatures of Post-Translational Modification