dbPTM

LAG1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LAG1_SCHPO
UniProt AC	P78970
Protein Name	Sphingosine N-acyltransferase lag1
Gene Name	lag1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	390
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein.
Protein Description	Component of the ceramide synthase complex required for C26-CoA-dependent ceramide synthesis. Facilitates ER-to-Golgi transport of GPI-anchored proteins (By similarity). Involved in the aging process (By similarity)..
Protein Sequence	MSNRKADEKHHMSSSSLTNDRSYIRNLSNRKTSISRKVPITRTLEDPSNFVAKDGTKLVQAPLFLLVWQKEICLSIIAICFACLLSPSLRPYAEPFIFLSYKQPDGSYGKGPKDACFPIFWVIVFTAFRVIVMDYVFRPFVLNWGVRNRKVIIRFCEQGYSFFYYLCFWFLGLYIYRSSNYWSNEEKLFEDYPQYYMSPLFKAYYLIQLGFWLQQILVLHLEQRRADHWQMFAHHIVTCALIILSYGFNFLRVGNAILYIFDLSDYILSGGKMLKYLGFGKICDYLFGIFVASWVYSRHYLFSKILRVVVTNAPEIIGGFHLDVPNGYIFNKPIYIAFIILLFTLQLLIYIWFGMIVKVAYRVFSGEEATDSRSDDEGEDEEASSTNEDK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
13	Phosphorylation	ADEKHHMSSSSLTND HCCCCCCCCHHCCCC	23.78	29996109
14	Phosphorylation	DEKHHMSSSSLTNDR CCCCCCCCHHCCCCH	19.17	29996109
15	Phosphorylation	EKHHMSSSSLTNDRS CCCCCCCHHCCCCHH	23.28	29996109
16	Phosphorylation	KHHMSSSSLTNDRSY CCCCCCHHCCCCHHH	40.95	29996109
18	Phosphorylation	HMSSSSLTNDRSYIR CCCCHHCCCCHHHHH	36.70	29996109
26	N-linked_Glycosylation	NDRSYIRNLSNRKTS CCHHHHHHHHCCCCC	37.96	-
370	Phosphorylation	VFSGEEATDSRSDDE HHCCCCCCCCCCCCC	37.47	29996109
372	Phosphorylation	SGEEATDSRSDDEGE CCCCCCCCCCCCCCC	29.36	28889911
374	Phosphorylation	EEATDSRSDDEGEDE CCCCCCCCCCCCCCH	54.06	28889911
384	Phosphorylation	EGEDEEASSTNEDK- CCCCHHHHCCCCCC-	40.76	25720772
385	Phosphorylation	GEDEEASSTNEDK-- CCCHHHHCCCCCC--	42.15	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LAG1_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LAG1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LAG1_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PFD2_SCHPO	SPAC227.10	genetic	19547744

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LAG1_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-372 AND SER-374, ANDMASS SPECTROMETRY.	18257517 [Abstract]