UniProt ID | PFD2_SCHPO | |
---|---|---|
UniProt AC | Q9UTC9 | |
Protein Name | Probable prefoldin subunit 2 | |
Gene Name | SPAC227.10 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 114 | |
Subcellular Localization | ||
Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity).. | |
Protein Sequence | MAEQPSRQQILQTQYNSYKSRLQQIAQKIVDLETDADEHKLVMDTLNSMDNNRRCFRMIHGVLVERTVGTVVPILKTTQEGIQTAMNGLLDQYKQLEAEFQKFQKDNKIQVVRQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PFD2_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
FIN1_SCHPO | fin1 | genetic | 18931302 | |
STE24_SCHPO | SPAC3H1.05 | genetic | 19547744 | |
AP3S_SCHPO | aps3 | genetic | 19547744 | |
VPS1_SCHPO | vps1 | genetic | 19547744 | |
FFT3_SCHPO | fft3 | genetic | 18818364 | |
YEG5_SCHPO | mga2 | genetic | 18818364 | |
TBCA_SCHPO | alp31 | genetic | 18818364 | |
ASE1_SCHPO | ase1 | genetic | 18818364 | |
ALP14_SCHPO | alp14 | genetic | 18818364 | |
MAD1_SCHPO | mad1 | genetic | 18818364 | |
PEF1_SCHPO | pef1 | genetic | 18818364 | |
IMP2L_SCHPO | SPBC336.13c | genetic | 22681890 | |
FIN1_SCHPO | fin1 | genetic | 22681890 | |
YEG5_SCHPO | mga2 | genetic | 22681890 | |
MCA1_SCHPO | pca1 | genetic | 22681890 | |
SUT1_SCHPO | sut1 | genetic | 22681890 | |
PPR8_SCHPO | ppr8 | genetic | 22681890 | |
ASK1_SCHPO | ask1 | genetic | 22681890 | |
SGT2_SCHPO | SPAC1142.02c | genetic | 22681890 | |
FFT3_SCHPO | fft3 | genetic | 22681890 | |
DAD2_SCHPO | dad2 | genetic | 22681890 | |
ASE1_SCHPO | ase1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...