| UniProt ID | TBCA_SCHPO | |
|---|---|---|
| UniProt AC | Q9Y703 | |
| Protein Name | Tubulin-specific chaperone A | |
| Gene Name | alp31 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 119 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Required for the maintenance of microtubule structures and cell polarity. Beta-tubulin-folding protein; may have a regulatory role in the tubulin-folding pathway.. | |
| Protein Sequence | MSNTVRSLVIKTNVVKRIIKDVELAHIDINEAEKRVQSKIDNGEDSAEIEHQKFVLKKHLEALPDALVRLRNATNDLESISSDSAYEGTPELEQANEYLEKAKEVIEKEQTNFPTNGYH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | KIDNGEDSAEIEHQK HCCCCCCCHHHHHHH | 24.41 | 21712547 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TBCA_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TBCA_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TBCA_SCHPO !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
