dbPTM

RTF_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RTF_SCHPO
UniProt AC	Q9UUI6
Protein Name	Replication termination factor 1
Gene Name	rtf1
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	466
Subcellular Localization	Nucleus .
Protein Description	Mediates site-specific replication termination at the polar replication barrier RTS1, a barrier which ensures that replication of the mat1 locus in S.pombe occurs in the centromere-proximal direction..
Protein Sequence	MQGKNNLSCRPDTEDNEELFVDDQLLSPIGDSKNTSSFIYLGNPISFHEYNYDETMVSPENVKTAIAGSAKDHETCRGFKKTGTTSYKDFVFSRDYTNWTPTFWVLLSQLIDEFLKESELNFVAARDLLIKTKRLPKPFNNLLIQFQIQVPNVSRRTVYRHLKGYFNIPGYERFQYVKKASSGSWGANDIITLEKEIAMFKKKKNWSDEQFLQYVWSDNHRDEMKTLYNCLYELIDRDKKSIYNYLRRKYNPFKKKCKWTIEDEAELKKLVEKHGTSWSLIGKLSNRLPMHCRDHWRDYIQPGEINRSPWTIQEKEKLIKTVNQYLQSNPSSPIQWSLISKNMRNRHRHHCRWKYYTLISRDIHNSSPFKLGDSIWLIERMMDLNVAEERMIDWKCLSEYANHLWTADACKSHFERIKKTLFIDGLSTFSDTLIHLHKMLNSSPEETYISNLHDSYTAFSNADDLC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
27	Phosphorylation	FVDDQLLSPIGDSKN EECCEEECCCCCCCC	24.06	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RTF_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RTF_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RTF_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
RTF_SCHPO	rtf1	physical	18723894

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RTF_SCHPO

Related Literatures of Post-Translational Modification