UniProt ID | PFD5_SCHPO | |
---|---|---|
UniProt AC | O94307 | |
Protein Name | Probable prefoldin subunit 5 | |
Gene Name | bob1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 154 | |
Subcellular Localization | Cytoplasm . Localizes to the cell tips and septum forming regions. | |
Protein Description | Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity). Required for normal cytoskeletal function and when bound to byr1, is involved in the regulation of sexual differentiation.. | |
Protein Sequence | MAEGNKAVDLTSLSLEQLSEVIKQLDSELEYLSTSYGQLGRAQLKFRECLANVNDAVRAENDGKEVLVPLTSSLYVPGKLNLGNSKLLVDIGTGYYVEKSAGEATEYYKRKCEYLASSIENLNNAIDAKSVQIRAVQNIMQQKATATTAATKSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PFD5_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PFD5_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PFD5_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PFD5_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...